BLASTX nr result
ID: Cinnamomum25_contig00006248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00006248 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009407490.1| PREDICTED: uncharacterized protein LOC103990... 57 4e-06 ref|XP_003577223.1| PREDICTED: selenoprotein H-like [Brachypodiu... 57 5e-06 ref|XP_003577209.1| PREDICTED: selenoprotein H-like [Brachypodiu... 57 5e-06 ref|XP_003561746.1| PREDICTED: selenoprotein H-like [Brachypodiu... 57 5e-06 >ref|XP_009407490.1| PREDICTED: uncharacterized protein LOC103990161 [Musa acuminata subsp. malaccensis] Length = 173 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 269 RTGSGNTFISLLNMPRPFKKMKDLDMDEVIEDIVKKL 159 R SG F+SLLNMPRPF MK LDMDEVI+DIVKK+ Sbjct: 136 REESGQIFVSLLNMPRPFTPMKKLDMDEVIQDIVKKI 172 >ref|XP_003577223.1| PREDICTED: selenoprotein H-like [Brachypodium distachyon] Length = 193 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 269 RTGSGNTFISLLNMPRPFKKMKDLDMDEVIEDIVKKLN 156 R G FISLLNMPRPF MK LDMDEVI+DIVKK++ Sbjct: 156 REEGGEVFISLLNMPRPFTAMKKLDMDEVIQDIVKKIS 193 >ref|XP_003577209.1| PREDICTED: selenoprotein H-like [Brachypodium distachyon] Length = 166 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 269 RTGSGNTFISLLNMPRPFKKMKDLDMDEVIEDIVKKLN 156 R G FISLLNMPRPF MK LDMDEVI+DIVKK++ Sbjct: 129 REEGGEVFISLLNMPRPFTAMKKLDMDEVIQDIVKKIS 166 >ref|XP_003561746.1| PREDICTED: selenoprotein H-like [Brachypodium distachyon] Length = 190 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 269 RTGSGNTFISLLNMPRPFKKMKDLDMDEVIEDIVKKLN 156 R G FISLLNMPRPF MK LDMDEVI+DIVKK++ Sbjct: 153 REEGGEVFISLLNMPRPFTAMKKLDMDEVIQDIVKKIS 190