BLASTX nr result
ID: Cinnamomum25_contig00000436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00000436 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||2203261A Cys protease inhibitor 89 1e-15 ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-... 77 3e-12 ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis th... 75 2e-11 gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabid... 75 2e-11 ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis th... 75 2e-11 ref|XP_010520100.1| PREDICTED: cysteine proteinase inhibitor 6 [... 74 3e-11 gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] 74 4e-11 ref|XP_010241469.1| PREDICTED: cysteine proteinase inhibitor 12-... 74 4e-11 ref|XP_011620718.1| PREDICTED: cysteine proteinase inhibitor iso... 74 5e-11 ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 i... 74 5e-11 emb|CDY08429.1| BnaA05g26650D [Brassica napus] 74 5e-11 emb|CDY42150.1| BnaC05g40690D [Brassica napus] 74 5e-11 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Ambore... 74 5e-11 gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] 73 8e-11 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 73 8e-11 gb|ACU24145.1| unknown [Glycine max] 73 8e-11 ref|XP_009120653.1| PREDICTED: cysteine proteinase inhibitor 6-l... 72 1e-10 gb|AAG31653.1| PRLI-interacting factor M [Arabidopsis thaliana] 72 1e-10 ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutr... 72 1e-10 ref|NP_001237443.1| uncharacterized protein LOC100499887 precurs... 72 1e-10 >prf||2203261A Cys protease inhibitor Length = 100 Score = 89.0 bits (219), Expect = 1e-15 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSSTSSDA 120 TLEVVEAGQKKIYEAKVWVK WENFKELQEFKPVGDSSSTSSDA Sbjct: 57 TLEVVEAGQKKIYEAKVWVKLWENFKELQEFKPVGDSSSTSSDA 100 >ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 239 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSD 123 TLEV+EAG+KKIYEAKVWVKPW NFKELQEFKPVGD+ + TSSD Sbjct: 97 TLEVIEAGKKKIYEAKVWVKPWLNFKELQEFKPVGDAPTFTSSD 140 >ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] gi|125991833|sp|Q8H0X6.2|CYT6_ARATH RecName: Full=Cysteine proteinase inhibitor 6; Short=AtCYS-6; AltName: Full=PIP-M; AltName: Full=PRLI-interacting factor M; Flags: Precursor gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis thaliana] gi|15795168|dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] gi|332641680|gb|AEE75201.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] Length = 234 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSDA*C 114 TLE++EAGQKK+YEAKVWVKPW NFKELQEFKP D+ + TSSD C Sbjct: 92 TLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 138 >gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] Length = 201 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSDA*C 114 TLE++EAGQKK+YEAKVWVKPW NFKELQEFKP D+ + TSSD C Sbjct: 59 TLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 105 >ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] gi|17473693|gb|AAL38303.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] gi|21554079|gb|AAM63160.1| cysteine proteinase inhibitor, putative [Arabidopsis thaliana] gi|332641681|gb|AEE75202.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] Length = 201 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSDA*C 114 TLE++EAGQKK+YEAKVWVKPW NFKELQEFKP D+ + TSSD C Sbjct: 59 TLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITSSDLGC 105 >ref|XP_010520100.1| PREDICTED: cysteine proteinase inhibitor 6 [Tarenaya hassleriana] Length = 201 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/44 (81%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSD 123 TLEV+EAG+KK+YEAKVWVKPW NFKELQEFK GDS S TSSD Sbjct: 59 TLEVIEAGKKKLYEAKVWVKPWMNFKELQEFKHAGDSPSITSSD 102 >gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSD 123 TLE +EAG+KK+YEAKVWVKPW NFKELQEFKP GD+ S TS+D Sbjct: 103 TLEAIEAGEKKLYEAKVWVKPWLNFKELQEFKPAGDAPSFTSAD 146 >ref|XP_010241469.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 186 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSD 123 TLEV+EA +KKIYEAKVWVKPW NFKELQEFKPVGD+ + TSSD Sbjct: 49 TLEVIEACKKKIYEAKVWVKPWLNFKELQEFKPVGDAPTFTSSD 92 >ref|XP_011620718.1| PREDICTED: cysteine proteinase inhibitor isoform X2 [Amborella trichopoda] Length = 128 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSSTSSD 123 TLE ++AG+ K+YEAKVW+KPWENFKEL+EF VGDSS TSSD Sbjct: 79 TLEAIDAGKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 121 >ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 isoform X1 [Amborella trichopoda] Length = 225 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSSTSSD 123 TLE ++AG+ K+YEAKVW+KPWENFKEL+EF VGDSS TSSD Sbjct: 79 TLEAIDAGKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 121 >emb|CDY08429.1| BnaA05g26650D [Brassica napus] Length = 229 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGD---SSSTSSDA*C 114 TLE+VEAG+KK+YEAKVWVKPW NFKELQEFKP D SS T SD C Sbjct: 85 TLEIVEAGKKKLYEAKVWVKPWLNFKELQEFKPASDAAPSSITPSDLGC 133 >emb|CDY42150.1| BnaC05g40690D [Brassica napus] Length = 203 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/49 (73%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGD---SSSTSSDA*C 114 TLE+VEAG+KK+YEAKVWVKPW NFKELQEFKP D SS T SD C Sbjct: 59 TLEIVEAGKKKLYEAKVWVKPWLNFKELQEFKPASDAAPSSITPSDLGC 107 >gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] Length = 206 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSSTSSD 123 TLE ++AG+ K+YEAKVW+KPWENFKEL+EF VGDSS TSSD Sbjct: 60 TLEAIDAGKNKLYEAKVWLKPWENFKELKEFNHVGDSSLTSSD 102 >gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGD-SSSTSSD 123 TLE +EAG+KK+YEAKVWVKPW NFKELQEFKP GD S TS+D Sbjct: 103 TLEAIEAGEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGD-SSSTSSD 123 TLE +EAG+KK+YEAKVWVKPW NFKELQEFKP GD S TS+D Sbjct: 103 TLEAIEAGEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGD-SSSTSSD 123 TLE +EAG+KK+YEAKVWVKPW NFKELQEFKP GD S TS+D Sbjct: 103 TLEAIEAGEKKLYEAKVWVKPWLNFKELQEFKPAGDVPSFTSAD 146 >ref|XP_009120653.1| PREDICTED: cysteine proteinase inhibitor 6-like [Brassica rapa] Length = 235 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSSTSS 126 TLE++EAG+KK+YEAKVWVKPW NFKELQEFKP D S S+ Sbjct: 89 TLEIIEAGKKKLYEAKVWVKPWLNFKELQEFKPASDDGSPSA 130 >gb|AAG31653.1| PRLI-interacting factor M [Arabidopsis thaliana] Length = 209 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSDA*C 114 TLE++EAGQKK+YEAKVWVKPW NFKELQEF P D+ + TSSD C Sbjct: 67 TLEILEAGQKKLYEAKVWVKPWLNFKELQEFTPASDAPAITSSDLGC 113 >ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] gi|312282949|dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila] gi|557108477|gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] Length = 234 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSDA*C 114 TLE+VEAG+KK+YEAKVWVKPW NFKELQEFKP D+ + T SD C Sbjct: 92 TLEIVEAGKKKLYEAKVWVKPWLNFKELQEFKPASDAPAITPSDLGC 138 >ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max] gi|255627437|gb|ACU14063.1| unknown [Glycine max] Length = 245 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 251 TLEVVEAGQKKIYEAKVWVKPWENFKELQEFKPVGDSSS-TSSD 123 TLE +EAG+KK+YEAK WVKPW NFKELQEFKP GD+ S TS+D Sbjct: 103 TLEAIEAGEKKLYEAKAWVKPWLNFKELQEFKPAGDAPSFTSAD 146