BLASTX nr result
ID: Cinnamomum24_contig00037524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037524 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007922458.1| hypothetical protein MYCFIDRAFT_41057 [Pseud... 57 7e-06 >ref|XP_007922458.1| hypothetical protein MYCFIDRAFT_41057 [Pseudocercospora fijiensis CIRAD86] gi|452985683|gb|EME85439.1| hypothetical protein MYCFIDRAFT_41057 [Pseudocercospora fijiensis CIRAD86] Length = 354 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 265 FTIFGDIFLKTAFVVFDESTGSPRLGFAEQ 176 FTIFGDIFLK+ FVVFDE+TGSPRLGFA Q Sbjct: 325 FTIFGDIFLKSVFVVFDETTGSPRLGFAGQ 354