BLASTX nr result
ID: Cinnamomum24_contig00037509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037509 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45419.1| hypothetical protein DOTSEDRAFT_170804 [Dothistro... 63 8e-08 >gb|EME45419.1| hypothetical protein DOTSEDRAFT_170804 [Dothistroma septosporum NZE10] Length = 161 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 277 FSPEEQRAIGEEWYWIAFERETAVRDYLRGYPP-RDGCYWR 158 F+ +EQ AI EEWYW+AFERETAV+DY+ GY DGC WR Sbjct: 95 FTRDEQLAIAEEWYWVAFERETAVKDYMNGYVTFTDGCTWR 135