BLASTX nr result
ID: Cinnamomum24_contig00037488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037488 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001906224.1| hypothetical protein [Podospora anserina S m... 59 1e-06 ref|XP_008093600.1| hypothetical protein GLRG_04724 [Colletotric... 57 7e-06 >ref|XP_001906224.1| hypothetical protein [Podospora anserina S mat+] gi|170941240|emb|CAP66890.1| unnamed protein product [Podospora anserina S mat+] gi|681098737|emb|CDP28632.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 325 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 Query: 252 NSGCMPSGSVCCSDGGYCDAGYYCAANDKCRREGS 148 N GCMPS VCC GGYCDAGY C + CRR GS Sbjct: 105 NRGCMPSSGVCCPGGGYCDAGYECTTTNTCRRAGS 139 >ref|XP_008093600.1| hypothetical protein GLRG_04724 [Colletotrichum graminicola M1.001] gi|310794119|gb|EFQ29580.1| hypothetical protein GLRG_04724 [Colletotrichum graminicola M1.001] Length = 346 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -2 Query: 252 NSGCMPSGSVCCSDGGYCDAGYYCAANDKCRREGS 148 N CMP+G+VCC GGYCDAG C A+ KCR+ GS Sbjct: 115 NGKCMPAGNVCCPGGGYCDAGETCTADRKCRKPGS 149