BLASTX nr result
ID: Cinnamomum24_contig00037317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037317 (302 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49364.1| hypothetical protein DOTSEDRAFT_68220 [Dothistrom... 60 5e-07 >gb|EME49364.1| hypothetical protein DOTSEDRAFT_68220 [Dothistroma septosporum NZE10] Length = 394 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 129 DFGVMLDKGQKNWKKVEPIAKPLLTQLAKTYLQGGGAGR 13 D M+ KGQ+NWKKV P+AKPLL+QLAKTYLQ G GR Sbjct: 355 DIDGMMAKGQENWKKVAPVAKPLLSQLAKTYLQNGAGGR 393