BLASTX nr result
ID: Cinnamomum24_contig00037300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037300 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF14542.1| hypothetical protein SEPMUDRAFT_62999 [Sphaerulin... 93 9e-17 gb|EME46088.1| hypothetical protein DOTSEDRAFT_70172 [Dothistrom... 93 9e-17 gb|KJX96025.1| hypothetical protein TI39_contig844g00026 [Zymose... 91 3e-16 ref|XP_003856090.1| hypothetical protein MYCGRDRAFT_102207 [Zymo... 91 3e-16 ref|XP_007926539.1| hypothetical protein MYCFIDRAFT_211282 [Pseu... 90 6e-16 ref|XP_007672293.1| hypothetical protein BAUCODRAFT_118821 [Baud... 89 1e-15 gb|KIW65874.1| hypothetical protein, variant [Capronia semiimmersa] 80 5e-13 gb|KIW65873.1| hypothetical protein PV04_08090 [Capronia semiimm... 80 5e-13 gb|KIV79756.1| hypothetical protein PV11_07301 [Exophiala sideris] 80 5e-13 ref|XP_008725037.1| hypothetical protein G647_02466 [Cladophialo... 80 5e-13 ref|XP_013348212.1| hypothetical protein AUEXF2481DRAFT_35837 [A... 80 8e-13 ref|XP_013427454.1| hypothetical protein M436DRAFT_46189 [Aureob... 80 8e-13 ref|XP_001268880.1| C2H2 transcription factor (Rpn4), putative [... 80 8e-13 gb|KEQ90137.1| hypothetical protein M438DRAFT_351454 [Aureobasid... 79 1e-12 gb|KEQ58971.1| hypothetical protein M437DRAFT_58413 [Aureobasidi... 79 1e-12 ref|XP_013263613.1| hypothetical protein A1O9_02587 [Exophiala a... 79 1e-12 ref|XP_013270498.1| hypothetical protein Z518_06914 [Rhinocladie... 79 2e-12 gb|EEH08594.1| conserved hypothetical protein [Histoplasma capsu... 79 2e-12 ref|XP_658313.1| hypothetical protein AN0709.2 [Aspergillus nidu... 79 2e-12 ref|XP_007759804.1| 26S proteasome regulatory subunit N4 [Cladop... 79 2e-12 >gb|EMF14542.1| hypothetical protein SEPMUDRAFT_62999 [Sphaerulina musiva SO2202] Length = 716 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRCPMCREEKTFSR+DALTRHMRVVHPEVESFGK Sbjct: 667 DTIHNGRKQKVRCPMCREEKTFSRNDALTRHMRVVHPEVESFGK 710 >gb|EME46088.1| hypothetical protein DOTSEDRAFT_70172 [Dothistroma septosporum NZE10] Length = 709 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRCPMCREEKTFSR+DALTRHMRVVHPEVESFGK Sbjct: 660 DTIHNGRKQKVRCPMCREEKTFSRNDALTRHMRVVHPEVESFGK 703 >gb|KJX96025.1| hypothetical protein TI39_contig844g00026 [Zymoseptoria brevis] Length = 689 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRCPMCREEKTFSR+DALTRHMRVVHPEVE FGK Sbjct: 641 DTIHNGRKQKVRCPMCREEKTFSRNDALTRHMRVVHPEVEDFGK 684 >ref|XP_003856090.1| hypothetical protein MYCGRDRAFT_102207 [Zymoseptoria tritici IPO323] gi|339475975|gb|EGP91066.1| hypothetical protein MYCGRDRAFT_102207 [Zymoseptoria tritici IPO323] Length = 92 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRCPMCREEKTFSR+DALTRHMRVVHPEVE FGK Sbjct: 44 DTIHNGRKQKVRCPMCREEKTFSRNDALTRHMRVVHPEVEEFGK 87 >ref|XP_007926539.1| hypothetical protein MYCFIDRAFT_211282 [Pseudocercospora fijiensis CIRAD86] gi|452983493|gb|EME83251.1| hypothetical protein MYCFIDRAFT_211282 [Pseudocercospora fijiensis CIRAD86] Length = 281 Score = 90.1 bits (222), Expect = 6e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRC MCREEKTFSR+DALTRHMRVVHPEVE+FGK Sbjct: 232 DTIHNNRKQKVRCLMCREEKTFSRNDALTRHMRVVHPEVEAFGK 275 >ref|XP_007672293.1| hypothetical protein BAUCODRAFT_118821 [Baudoinia panamericana UAMH 10762] gi|449305102|gb|EMD01109.1| hypothetical protein BAUCODRAFT_118821 [Baudoinia panamericana UAMH 10762] Length = 709 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRCPMCR+EKTFSR+DALTRHMRVVHPEVE G+ Sbjct: 660 DTIHNNRKQKVRCPMCRDEKTFSRNDALTRHMRVVHPEVEELGR 703 >gb|KIW65874.1| hypothetical protein, variant [Capronia semiimmersa] Length = 537 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 487 DTIHNNRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 530 >gb|KIW65873.1| hypothetical protein PV04_08090 [Capronia semiimmersa] Length = 555 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 505 DTIHNNRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 548 >gb|KIV79756.1| hypothetical protein PV11_07301 [Exophiala sideris] Length = 545 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 495 DTIHNNRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 538 >ref|XP_008725037.1| hypothetical protein G647_02466 [Cladophialophora carrionii CBS 160.54] gi|565936489|gb|ETI25692.1| hypothetical protein G647_02466 [Cladophialophora carrionii CBS 160.54] Length = 526 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRKQKVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 476 DTIHNNRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 519 >ref|XP_013348212.1| hypothetical protein AUEXF2481DRAFT_35837 [Aureobasidium subglaciale EXF-2481] gi|662542611|gb|KEQ99909.1| hypothetical protein AUEXF2481DRAFT_35837 [Aureobasidium subglaciale EXF-2481] Length = 635 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN +KQKVRC CREEKTFSR+DALTRHMRVVHPEV+ GK Sbjct: 584 DTIHNRQKQKVRCQYCREEKTFSRADALTRHMRVVHPEVDFHGK 627 >ref|XP_013427454.1| hypothetical protein M436DRAFT_46189 [Aureobasidium namibiae CBS 147.97] gi|662515659|gb|KEQ73224.1| hypothetical protein M436DRAFT_46189 [Aureobasidium namibiae CBS 147.97] Length = 95 Score = 79.7 bits (195), Expect = 8e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN +KQKVRC CREEKTFSR+DALTRHMRVVHPEV+ GK Sbjct: 44 DTIHNRQKQKVRCQYCREEKTFSRADALTRHMRVVHPEVDFHGK 87 >ref|XP_001268880.1| C2H2 transcription factor (Rpn4), putative [Aspergillus clavatus NRRL 1] gi|119397023|gb|EAW07454.1| C2H2 transcription factor (Rpn4), putative [Aspergillus clavatus NRRL 1] Length = 747 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRC +CREEKTFSR+DALTRHMRVVHPEV+ GK Sbjct: 697 DTIHNARKQKVRCHLCREEKTFSRNDALTRHMRVVHPEVDWPGK 740 >gb|KEQ90137.1| hypothetical protein M438DRAFT_351454 [Aureobasidium pullulans EXF-150] Length = 789 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN +KQKVRC CREEKTFSR+DALTRHMRVVHPE++ GK Sbjct: 738 DTIHNRQKQKVRCQYCREEKTFSRADALTRHMRVVHPEIDFHGK 781 >gb|KEQ58971.1| hypothetical protein M437DRAFT_58413 [Aureobasidium melanogenum CBS 110374] Length = 95 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN +KQKVRC CREEKTFSR+DALTRHMRVVHPE++ GK Sbjct: 44 DTIHNRQKQKVRCQYCREEKTFSRADALTRHMRVVHPEIDFHGK 87 >ref|XP_013263613.1| hypothetical protein A1O9_02587 [Exophiala aquamarina CBS 119918] gi|656915444|gb|KEF61023.1| hypothetical protein A1O9_02587 [Exophiala aquamarina CBS 119918] Length = 526 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRC +C EEKTFSR+DALTRHMRVVHPEV+ GK Sbjct: 476 DTIHNGRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPEVDWVGK 519 >ref|XP_013270498.1| hypothetical protein Z518_06914 [Rhinocladiella mackenziei CBS 650.93] gi|759327033|gb|KIX03362.1| hypothetical protein Z518_06914 [Rhinocladiella mackenziei CBS 650.93] Length = 516 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN+RKQKVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 466 DTIHNSRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 509 >gb|EEH08594.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] Length = 842 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN+RKQKVRC +C EEKTFSR+DALTRHMRVVHPEV+ GK Sbjct: 792 DTIHNSRKQKVRCHLCTEEKTFSRNDALTRHMRVVHPEVDWPGK 835 >ref|XP_658313.1| hypothetical protein AN0709.2 [Aspergillus nidulans FGSC A4] gi|40746030|gb|EAA65186.1| hypothetical protein AN0709.2 [Aspergillus nidulans FGSC A4] gi|49618685|gb|AAT67992.1| SILG [Aspergillus nidulans] gi|259489017|tpe|CBF88942.1| TPA: Putative uncharacterized proteinSILG ; [Source:UniProtKB/TrEMBL;Acc:Q5BFH1] [Aspergillus nidulans FGSC A4] Length = 703 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHN RKQKVRC +C EEKTFSR+DALTRHMRVVHPEVE GK Sbjct: 653 DTIHNARKQKVRCHLCTEEKTFSRNDALTRHMRVVHPEVEWPGK 696 >ref|XP_007759804.1| 26S proteasome regulatory subunit N4 [Cladophialophora yegresii CBS 114405] gi|589973952|gb|EXJ57270.1| 26S proteasome regulatory subunit N4 [Cladophialophora yegresii CBS 114405] Length = 526 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -2 Query: 314 DTIHNNRKQKVRCPMCREEKTFSRSDALTRHMRVVHPEVESFGK 183 DTIHNNRK KVRC +C EEKTFSR+DALTRHMRVVHP+V+ GK Sbjct: 476 DTIHNNRKMKVRCHLCTEEKTFSRNDALTRHMRVVHPDVDWVGK 519