BLASTX nr result
ID: Cinnamomum24_contig00037272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037272 (271 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41662.1| hypothetical protein DOTSEDRAFT_73906 [Dothistrom... 58 2e-06 >gb|EME41662.1| hypothetical protein DOTSEDRAFT_73906 [Dothistroma septosporum NZE10] Length = 195 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -2 Query: 267 KLVKSEYEMLDADGEAI--APSKDKKRRTKTATQQRAAMVPDVDDDYEFV 124 +LVKSEYE+LD+DGE + A K KK + +++ Q A +VPD D+DYEFV Sbjct: 146 QLVKSEYELLDSDGETMKAASKKGKKNKARSSASQEAVIVPDADEDYEFV 195