BLASTX nr result
ID: Cinnamomum24_contig00037219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037219 (263 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX92612.1| peroxisomal membrane protein PEX13 [Zymoseptoria ... 69 1e-09 ref|XP_007930109.1| hypothetical protein MYCFIDRAFT_156680 [Pseu... 63 1e-07 ref|XP_007677466.1| hypothetical protein BAUCODRAFT_35348 [Baudo... 60 8e-07 ref|XP_003852291.1| hypothetical protein MYCGRDRAFT_72443 [Zymos... 59 1e-06 gb|EME44114.1| hypothetical protein DOTSEDRAFT_71796 [Dothistrom... 57 7e-06 >gb|KJX92612.1| peroxisomal membrane protein PEX13 [Zymoseptoria brevis] Length = 458 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -2 Query: 262 RANSMAITQKEKAEIQKTPKEPPKI-HTKQGDVPIESFQRGAFYS 131 RANSM IT++EKAE+QK PKE PK+ K GDVP+ESFQRGAFYS Sbjct: 414 RANSMKITEREKAEVQKAPKEAPKLPQGKMGDVPVESFQRGAFYS 458 >ref|XP_007930109.1| hypothetical protein MYCFIDRAFT_156680 [Pseudocercospora fijiensis CIRAD86] gi|452979623|gb|EME79385.1| hypothetical protein MYCFIDRAFT_156680 [Pseudocercospora fijiensis CIRAD86] Length = 451 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -2 Query: 262 RANSMAITQKEKAEIQKTPKE-PPKIHTKQGDVPIESFQRGAFYS 131 RANSM IT KEKAE++K PK PP I K GD+P+ESFQRGAF S Sbjct: 407 RANSMKITDKEKAEVKKAPKHLPPAIRGKAGDIPLESFQRGAFNS 451 >ref|XP_007677466.1| hypothetical protein BAUCODRAFT_35348 [Baudoinia panamericana UAMH 10762] gi|449299352|gb|EMC95366.1| hypothetical protein BAUCODRAFT_35348 [Baudoinia panamericana UAMH 10762] Length = 449 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 262 RANSMAITQKEKAEIQKTPKEPPKIHTKQGDVPIESFQRGAFYS 131 RANSMAIT KEKA+++ + KEPPK+ K D+ +ESFQR AF S Sbjct: 406 RANSMAITDKEKAQVRASSKEPPKVEGKPADISVESFQRAAFTS 449 >ref|XP_003852291.1| hypothetical protein MYCGRDRAFT_72443 [Zymoseptoria tritici IPO323] gi|339472172|gb|EGP87267.1| hypothetical protein MYCGRDRAFT_72443 [Zymoseptoria tritici IPO323] Length = 465 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -2 Query: 262 RANSMAITQKEKAEIQKTPKEPPKIHT--KQGDVPIESFQRGAFYS 131 RANSM IT++EKAE++K KE P + K GDVP+ESFQRGAFYS Sbjct: 420 RANSMKITEREKAEVKKAGKEAPPMLPVGKGGDVPVESFQRGAFYS 465 >gb|EME44114.1| hypothetical protein DOTSEDRAFT_71796 [Dothistroma septosporum NZE10] Length = 456 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 262 RANSMAITQKEKAEIQKTPKEPPKIHTKQGDVPIESFQRGAFYS 131 RANSM IT KE AEI+K P+ PP K GDVP+ESFQR AF+S Sbjct: 416 RANSMKITDKENAEIKKAPRLPP---GKGGDVPVESFQRAAFHS 456