BLASTX nr result
ID: Cinnamomum24_contig00037159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037159 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ64122.1| hypothetical protein M437DRAFT_28815, partial [Au... 70 5e-10 gb|KEQ88631.1| hypothetical protein M438DRAFT_361937 [Aureobasid... 69 1e-09 ref|XP_013423373.1| hypothetical protein M436DRAFT_85826 [Aureob... 66 9e-09 gb|EYE90808.1| hypothetical protein EURHEDRAFT_381680 [Aspergill... 64 3e-08 dbj|GAM39720.1| hypothetical protein TCE0_034r11495 [Talaromyces... 62 2e-07 emb|CEJ57502.1| hypothetical protein PMG11_06193 [Penicillium br... 60 6e-07 ref|XP_007756001.1| hypothetical protein A1O7_03794 [Cladophialo... 59 2e-06 ref|XP_008723591.1| hypothetical protein G647_01970 [Cladophialo... 59 2e-06 gb|KIW69677.1| hypothetical protein PV04_05539 [Capronia semiimm... 58 2e-06 dbj|GAM90281.1| hypothetical protein ANO11243_083230 [fungal sp.... 58 3e-06 ref|XP_013314553.1| hypothetical protein PV05_06368 [Exophiala x... 57 5e-06 ref|XP_002479867.1| conserved hypothetical protein [Talaromyces ... 57 7e-06 >gb|KEQ64122.1| hypothetical protein M437DRAFT_28815, partial [Aureobasidium melanogenum CBS 110374] Length = 53 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQDPAKLRSVNEKVTDFGRDKFEKMT 2 EDYVDKGLDS+ERK+GQDP+KLRSVNEKVTD R FEK T Sbjct: 3 EDYVDKGLDSLERKEGQDPSKLRSVNEKVTDTARGMFEKAT 43 >gb|KEQ88631.1| hypothetical protein M438DRAFT_361937 [Aureobasidium pullulans EXF-150] Length = 59 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQDPAKLRSVNEKVTDFGRDKFEKMT 2 EDYVDKGLDS+E+KQGQDP KLRSVNEKVTD R FEK T Sbjct: 9 EDYVDKGLDSLEKKQGQDPNKLRSVNEKVTDKARGMFEKAT 49 >ref|XP_013423373.1| hypothetical protein M436DRAFT_85826 [Aureobasidium namibiae CBS 147.97] gi|662511599|gb|KEQ69178.1| hypothetical protein M436DRAFT_85826 [Aureobasidium namibiae CBS 147.97] Length = 64 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQDPAKLRSVNEKVTDFGRDKFEKMT 2 EDY+DKG+DS+E+K+GQDP KLRSVNEKVTD R FEK T Sbjct: 14 EDYLDKGIDSLEKKEGQDPNKLRSVNEKVTDTARGMFEKAT 54 >gb|EYE90808.1| hypothetical protein EURHEDRAFT_381680 [Aspergillus ruber CBS 135680] Length = 83 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQDPAKLRSVNEKVTDFGRDKFEKMT 2 EDYVDKGLDS+E+K G DP+KLR NEK+TD GR +FE T Sbjct: 33 EDYVDKGLDSVEKKYGADPSKLRGTNEKITDAGRQQFESRT 73 >dbj|GAM39720.1| hypothetical protein TCE0_034r11495 [Talaromyces cellulolyticus] Length = 72 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = -3 Query: 127 NEDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 NEDY+DKGLD +E+K GQ DPAK+RS NEK+TD R FEKMT Sbjct: 18 NEDYLDKGLDFVEKKFGQGKVDPAKMRSTNEKITDGARSMFEKMT 62 >emb|CEJ57502.1| hypothetical protein PMG11_06193 [Penicillium brasilianum] Length = 82 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = -3 Query: 127 NEDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 NEDY+DK LDS ERK G DPAK+RS NEK+TD R++FEK+T Sbjct: 28 NEDYLDKALDSAERKYGGGKVDPAKMRSTNEKITDGAREQFEKLT 72 >ref|XP_007756001.1| hypothetical protein A1O7_03794 [Cladophialophora yegresii CBS 114405] gi|589976364|gb|EXJ59648.1| hypothetical protein A1O7_03794 [Cladophialophora yegresii CBS 114405] Length = 66 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 EDY+DKGLD+ E++ GQ DPAK RSVNEKVTD RD FEK T Sbjct: 13 EDYLDKGLDAAEKRFGQGKIDPAKSRSVNEKVTDKARDMFEKAT 56 >ref|XP_008723591.1| hypothetical protein G647_01970 [Cladophialophora carrionii CBS 160.54] gi|565940411|gb|ETI29517.1| hypothetical protein G647_01970 [Cladophialophora carrionii CBS 160.54] Length = 66 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 EDY+DKGLD+ E++ GQ DPAK RSVNEKVTD RD FEK T Sbjct: 13 EDYLDKGLDAAEKRFGQGKVDPAKSRSVNEKVTDKARDMFEKAT 56 >gb|KIW69677.1| hypothetical protein PV04_05539 [Capronia semiimmersa] Length = 66 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 3/44 (6%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 EDY+DKGLD+ E++ GQ DPAK RSVNEKVTD RD FEK T Sbjct: 13 EDYLDKGLDAAEKRFGQGKVDPAKSRSVNEKVTDKARDLFEKAT 56 >dbj|GAM90281.1| hypothetical protein ANO11243_083230 [fungal sp. No.11243] Length = 72 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQDPAKLRSVNEKVTDFGRDKFEKMT 2 EDY DKGLD +ERK G+DP +RS NEK+TD R FEK T Sbjct: 22 EDYADKGLDFLERKGGKDPQSMRSTNEKITDKARGMFEKAT 62 >ref|XP_013314553.1| hypothetical protein PV05_06368 [Exophiala xenobiotica] gi|759277464|gb|KIW53969.1| hypothetical protein PV05_06368 [Exophiala xenobiotica] Length = 152 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = -3 Query: 124 EDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 EDY+DKGLD+ E++ GQ DPAK RS NEKVTD RD FEK T Sbjct: 12 EDYLDKGLDAAEKRFGQGKVDPAKQRSTNEKVTDKARDMFEKAT 55 >ref|XP_002479867.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218720014|gb|EED19433.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 75 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 3/45 (6%) Frame = -3 Query: 127 NEDYVDKGLDSIERKQGQ---DPAKLRSVNEKVTDFGRDKFEKMT 2 NEDY+DKGLD E+K GQ DP K+R NEK+TD R+ FEK+T Sbjct: 21 NEDYLDKGLDFAEKKYGQGKIDPVKMRDTNEKITDGARNLFEKVT 65