BLASTX nr result
ID: Cinnamomum24_contig00037114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00037114 (246 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_037564919.1| hypothetical protein [Staphylococcus agnetis] 102 1e-19 emb|CEG21162.1| hypothetical protein BN1080_00055 [Planomicrobiu... 70 5e-10 >ref|WP_037564919.1| hypothetical protein [Staphylococcus agnetis] Length = 59 Score = 102 bits (253), Expect = 1e-19 Identities = 46/55 (83%), Positives = 48/55 (87%) Frame = +3 Query: 81 MLLPSGPDMIHGFILHRTEIFRHYVLWADFTKTHPQQRN*VSHKADFEYREPLPP 245 MLLPSGPDM+HGFILH TEIF+H VLWADFT THPQQRN SHKA FE REPLPP Sbjct: 1 MLLPSGPDMVHGFILHGTEIFKHLVLWADFTNTHPQQRNSASHKAVFENREPLPP 55 >emb|CEG21162.1| hypothetical protein BN1080_00055 [Planomicrobium sp. ES2] Length = 135 Score = 70.5 bits (171), Expect = 5e-10 Identities = 40/80 (50%), Positives = 46/80 (57%) Frame = +3 Query: 3 SNAYHKRYQSRQLNLGNPTAHTMIHLMLLPSGPDMIHGFILHRTEIFRHYVLWADFTKTH 182 S A HKRY R L+LGNP AH HLMLLPSGPDM+HGF L RT+ +T Sbjct: 35 STAAHKRYPCRWLDLGNPAAHEKFHLMLLPSGPDMVHGFPLRRTQTSTLRARGRPCIQT- 93 Query: 183 PQQRN*VSHKADFEYREPLP 242 +RN V + YR PLP Sbjct: 94 ASERNSVLLERIAGYRTPLP 113