BLASTX nr result
ID: Cinnamomum24_contig00036996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036996 (266 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007685833.1| hypothetical protein COCMIDRAFT_24490 [Bipol... 70 5e-10 ref|XP_007777413.1| 40S ribosomal protein S13 [Coniosporium apol... 70 5e-10 gb|EMF10712.1| 40S ribosomal protein S13 [Sphaerulina musiva SO2... 70 5e-10 ref|XP_007930170.1| hypothetical protein MYCFIDRAFT_87337 [Pseud... 70 5e-10 gb|EME44003.1| hypothetical protein DOTSEDRAFT_71721 [Dothistrom... 70 5e-10 ref|XP_014081353.1| hypothetical protein COCC4DRAFT_163354 [Bipo... 70 5e-10 ref|XP_007700954.1| hypothetical protein COCSADRAFT_27715 [Bipol... 70 5e-10 ref|XP_007677601.1| hypothetical protein BAUCODRAFT_72879 [Baudo... 70 5e-10 ref|XP_001938190.1| 40S ribosomal protein S13 [Pyrenophora triti... 70 8e-10 dbj|GAM88512.1| hypothetical protein ANO11243_065450 [fungal sp.... 69 1e-09 ref|XP_002841499.1| 40S ribosomal protein S13 [Tuber melanosporu... 69 1e-09 gb|KOS45665.1| hypothetical protein ACN38_g3422 [Penicillium nor... 69 1e-09 gb|KNG46609.1| 40s ribosomal protein s13 [Stemphylium lycopersici] 69 1e-09 emb|CDM35675.1| 40S ribosomal protein S13 [Penicillium roquefort... 69 1e-09 gb|KMU78419.1| 40S ribosomal protein S13 [Coccidioides immitis R... 69 1e-09 emb|CEJ62137.1| Putative 40S ribosomal protein S13 [Penicillium ... 69 1e-09 gb|KKZ63486.1| 40S ribosomal protein S13 [Emmonsia crescens UAMH... 69 1e-09 emb|CRG86635.1| 40S ribosomal protein S13-1 [Talaromyces islandi... 69 1e-09 ref|XP_013327816.1| 40S ribosomal protein S13 [Rasamsonia emerso... 69 1e-09 gb|KIN04719.1| hypothetical protein OIDMADRAFT_17657 [Oidiodendr... 69 1e-09 >ref|XP_007685833.1| hypothetical protein COCMIDRAFT_24490 [Bipolaris oryzae ATCC 44560] gi|628196116|ref|XP_007709745.1| hypothetical protein COCCADRAFT_89275 [Bipolaris zeicola 26-R-13] gi|953432629|ref|XP_014558386.1| hypothetical protein COCVIDRAFT_25061 [Bipolaris victoriae FI3] gi|576921893|gb|EUC36028.1| hypothetical protein COCCADRAFT_89275 [Bipolaris zeicola 26-R-13] gi|576934102|gb|EUC47620.1| hypothetical protein COCMIDRAFT_24490 [Bipolaris oryzae ATCC 44560] gi|578491411|gb|EUN28818.1| hypothetical protein COCVIDRAFT_25061 [Bipolaris victoriae FI3] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_007777413.1| 40S ribosomal protein S13 [Coniosporium apollinis CBS 100218] gi|494824842|gb|EON62096.1| 40S ribosomal protein S13 [Coniosporium apollinis CBS 100218] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >gb|EMF10712.1| 40S ribosomal protein S13 [Sphaerulina musiva SO2202] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_007930170.1| hypothetical protein MYCFIDRAFT_87337 [Pseudocercospora fijiensis CIRAD86] gi|452979695|gb|EME79457.1| hypothetical protein MYCFIDRAFT_87337 [Pseudocercospora fijiensis CIRAD86] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >gb|EME44003.1| hypothetical protein DOTSEDRAFT_71721 [Dothistroma septosporum NZE10] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_014081353.1| hypothetical protein COCC4DRAFT_163354 [Bipolaris maydis ATCC 48331] gi|452001799|gb|EMD94258.1| hypothetical protein COCHEDRAFT_1130714 [Bipolaris maydis C5] gi|477590370|gb|ENI07444.1| hypothetical protein COCC4DRAFT_163354 [Bipolaris maydis ATCC 48331] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_007700954.1| hypothetical protein COCSADRAFT_27715 [Bipolaris sorokiniana ND90Pr] gi|451849976|gb|EMD63279.1| hypothetical protein COCSADRAFT_27715 [Bipolaris sorokiniana ND90Pr] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_007677601.1| hypothetical protein BAUCODRAFT_72879 [Baudoinia panamericana UAMH 10762] gi|449299304|gb|EMC95318.1| hypothetical protein BAUCODRAFT_72879 [Baudoinia panamericana UAMH 10762] Length = 151 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 151 >ref|XP_001938190.1| 40S ribosomal protein S13 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330916734|ref|XP_003297542.1| 40S ribosomal protein S13 [Pyrenophora teres f. teres 0-1] gi|187985289|gb|EDU50777.1| 40S ribosomal protein S13 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311329733|gb|EFQ94362.1| hypothetical protein PTT_07971 [Pyrenophora teres f. teres 0-1] Length = 151 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTWRYESATAST+VA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWRYESATASTMVA 151 >dbj|GAM88512.1| hypothetical protein ANO11243_065450 [fungal sp. No.11243] Length = 151 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTW+YESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWKYESATASTLVA 151 >ref|XP_002841499.1| 40S ribosomal protein S13 [Tuber melanosporum Mel28] gi|295637739|emb|CAZ85690.1| unnamed protein product [Tuber melanosporum] Length = 151 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVGALPPTW+YESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGALPPTWKYESATASTLVA 151 >gb|KOS45665.1| hypothetical protein ACN38_g3422 [Penicillium nordicum] Length = 196 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 164 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 196 >gb|KNG46609.1| 40s ribosomal protein s13 [Stemphylium lycopersici] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYK+VGALPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKSVGALPPTWRYESATASTLVA 151 >emb|CDM35675.1| 40S ribosomal protein S13 [Penicillium roqueforti FM164] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 151 >gb|KMU78419.1| 40S ribosomal protein S13 [Coccidioides immitis RMSCC 3703] Length = 83 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 51 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 83 >emb|CEJ62137.1| Putative 40S ribosomal protein S13 [Penicillium brasilianum] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 151 >gb|KKZ63486.1| 40S ribosomal protein S13 [Emmonsia crescens UAMH 3008] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 151 >emb|CRG86635.1| 40S ribosomal protein S13-1 [Talaromyces islandicus] Length = 717 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 685 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 717 >ref|XP_013327816.1| 40S ribosomal protein S13 [Rasamsonia emersonii CBS 393.64] gi|802091472|gb|KKA21204.1| 40S ribosomal protein S13 [Rasamsonia emersonii CBS 393.64] Length = 215 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 183 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 215 >gb|KIN04719.1| hypothetical protein OIDMADRAFT_17657 [Oidiodendron maius Zn] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 264 ESRIHRLSRYYKTVGALPPTWRYESATASTLVA 166 ESRIHRLSRYYKTVG LPPTWRYESATASTLVA Sbjct: 119 ESRIHRLSRYYKTVGVLPPTWRYESATASTLVA 151