BLASTX nr result
ID: Cinnamomum24_contig00036899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036899 (243 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003848865.1| hypothetical protein MYCGRDRAFT_76293 [Zymos... 62 2e-07 ref|XP_007922629.1| hypothetical protein MYCFIDRAFT_59363 [Pseud... 59 1e-06 >ref|XP_003848865.1| hypothetical protein MYCGRDRAFT_76293 [Zymoseptoria tritici IPO323] gi|339468741|gb|EGP83841.1| hypothetical protein MYCGRDRAFT_76293 [Zymoseptoria tritici IPO323] gi|796710648|gb|KJY01587.1| mitochondrial cytochrome c oxidase subunit V like protein [Zymoseptoria brevis] Length = 181 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MLRTTPLLRQLPASLQASRTATATLTPLASRTQ-QQVRCAHAVSNPTL 3 MLRT PLLRQLPA++Q+ RTA AT P A ++ QQ R AHA+SNPTL Sbjct: 1 MLRTAPLLRQLPATVQSGRTAAATFAPFARQSSLQQTRSAHAISNPTL 48 >ref|XP_007922629.1| hypothetical protein MYCFIDRAFT_59363 [Pseudocercospora fijiensis CIRAD86] gi|452986431|gb|EME86187.1| hypothetical protein MYCFIDRAFT_59363 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 143 MLRTTPLLRQLPASLQASRTATATLTPLASRTQQQVRCAHAVSNPTL 3 MLR TPLLR+LP+SL ++R A+LTPLA QQVR AHA+SNPTL Sbjct: 3 MLRITPLLRRLPSSLASTRATAASLTPLA--RSQQVRNAHAISNPTL 47