BLASTX nr result
ID: Cinnamomum24_contig00036835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036835 (246 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44098.1| hypothetical protein DOTSEDRAFT_71785 [Dothistrom... 45 1e-09 >gb|EME44098.1| hypothetical protein DOTSEDRAFT_71785 [Dothistroma septosporum NZE10] Length = 806 Score = 45.4 bits (106), Expect(2) = 1e-09 Identities = 24/49 (48%), Positives = 29/49 (59%) Frame = -2 Query: 149 YPSLTNSMDTIGTHPRTRTNDXXXXXXXXXXXRGGHALALPQSPRYPKS 3 YPSLTNS+DTI +HPRT T D LA+P SPR+P+S Sbjct: 204 YPSLTNSIDTISSHPRTMTID-SQRSHRSNTQTSERGLAVPLSPRWPRS 251 Score = 43.5 bits (101), Expect(2) = 1e-09 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -3 Query: 244 DYFAIGMPRATSPEQVEESTHFVNIHAPSPND 149 DYF I PRA+SPE V+ + FVN+ APSPND Sbjct: 174 DYFGISAPRASSPEPVDST--FVNVQAPSPND 203