BLASTX nr result
ID: Cinnamomum24_contig00036771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036771 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001806136.1| hypothetical protein SNOG_16005 [Parastagono... 60 6e-07 >ref|XP_001806136.1| hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] gi|111055464|gb|EAT76584.1| hypothetical protein SNOG_16005 [Parastagonospora nodorum SN15] Length = 41 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 262 MGLMWTKHFXXXXXXXGVIVDKNGVRRAPFRISCGRFSCFR 140 MGLMW K F GV+ D++GVRRAPFR+SCGRFSCFR Sbjct: 1 MGLMWHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41