BLASTX nr result
ID: Cinnamomum24_contig00036768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036768 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163314.1| hypothetical protein PHAVU_001G224400g [Phas... 137 4e-30 ref|XP_014495882.1| PREDICTED: uncharacterized protein LOC106757... 135 2e-29 gb|KOM39284.1| hypothetical protein LR48_Vigan03g266600 [Vigna a... 132 1e-28 gb|KHN16045.1| hypothetical protein glysoja_012021 [Glycine soja... 131 2e-28 ref|NP_001237907.1| uncharacterized protein LOC100500427 [Glycin... 131 2e-28 gb|AFK47875.1| unknown [Lotus japonicus] 130 4e-28 ref|XP_010024143.1| PREDICTED: uncharacterized protein LOC104414... 130 5e-28 ref|XP_007206043.1| hypothetical protein PRUPE_ppa012574mg [Prun... 129 7e-28 gb|KRH68428.1| hypothetical protein GLYMA_03G230600 [Glycine max] 129 9e-28 gb|KHN03925.1| hypothetical protein glysoja_022611 [Glycine soja] 129 9e-28 ref|NP_001238325.1| uncharacterized protein LOC100306660 [Glycin... 129 9e-28 ref|XP_008246159.1| PREDICTED: uncharacterized protein LOC103344... 129 1e-27 ref|XP_007031193.1| Uncharacterized protein TCM_026789 [Theobrom... 128 1e-27 ref|XP_004494532.1| PREDICTED: uncharacterized protein LOC101506... 128 2e-27 ref|XP_008370369.1| PREDICTED: uncharacterized protein LOC103433... 127 4e-27 ref|XP_009337639.1| PREDICTED: uncharacterized protein LOC103930... 126 6e-27 ref|XP_012088865.1| PREDICTED: uncharacterized protein LOC105647... 126 7e-27 ref|XP_008388456.1| PREDICTED: uncharacterized protein At5g01610... 125 1e-26 ref|XP_013450442.1| plant/F25P12-18 protein [Medicago truncatula... 124 2e-26 ref|XP_002307069.2| hypothetical protein POPTR_0005s01470g [Popu... 124 2e-26 >ref|XP_007163314.1| hypothetical protein PHAVU_001G224400g [Phaseolus vulgaris] gi|543177584|gb|AGV54813.1| hypothetical protein [Phaseolus vulgaris] gi|543177586|gb|AGV54814.1| hypothetical protein [Phaseolus vulgaris] gi|561036778|gb|ESW35308.1| hypothetical protein PHAVU_001G224400g [Phaseolus vulgaris] Length = 161 Score = 137 bits (344), Expect = 4e-30 Identities = 64/77 (83%), Positives = 73/77 (94%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTAHVE G+I KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GLYRS Sbjct: 72 GKLVSYAPEVTAHVEQGRISKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLYRS 131 Query: 62 FPVSAFEIEEKTKENKQ 12 FPVSAFEIEE+ +E+K+ Sbjct: 132 FPVSAFEIEEEPQESKR 148 >ref|XP_014495882.1| PREDICTED: uncharacterized protein LOC106757663 [Vigna radiata var. radiata] Length = 161 Score = 135 bits (339), Expect = 2e-29 Identities = 64/80 (80%), Positives = 73/80 (91%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTAHVE GKI KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL+RS Sbjct: 72 GKLVSYAPEVTAHVEKGKISKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLFRS 131 Query: 62 FPVSAFEIEEKTKENKQGNE 3 FPVSAFEIEE+ + +K+ E Sbjct: 132 FPVSAFEIEEQAQASKRVEE 151 >gb|KOM39284.1| hypothetical protein LR48_Vigan03g266600 [Vigna angularis] Length = 161 Score = 132 bits (331), Expect = 1e-28 Identities = 63/80 (78%), Positives = 72/80 (90%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA VE GKI KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL+RS Sbjct: 72 GKLVSYAPEVTARVEKGKISKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLFRS 131 Query: 62 FPVSAFEIEEKTKENKQGNE 3 FPVSAFEIEE+ + +K+ E Sbjct: 132 FPVSAFEIEEEAQASKRVEE 151 >gb|KHN16045.1| hypothetical protein glysoja_012021 [Glycine soja] gi|947085073|gb|KRH33794.1| hypothetical protein GLYMA_10G145900 [Glycine max] Length = 178 Score = 131 bits (330), Expect = 2e-28 Identities = 62/80 (77%), Positives = 73/80 (91%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PE+TA+VE GKIKKL+GVKTKELL+W++LS+I+VDDPPTGKITFKTPSGL+R+ Sbjct: 72 GKLVSYAPEITAYVEVGKIKKLTGVKTKELLVWITLSEIFVDDPPTGKITFKTPSGLFRT 131 Query: 62 FPVSAFEIEEKTKENKQGNE 3 FPVSAFEIEE KE K+ E Sbjct: 132 FPVSAFEIEEPVKEVKEKEE 151 >ref|NP_001237907.1| uncharacterized protein LOC100500427 [Glycine max] gi|255630313|gb|ACU15513.1| unknown [Glycine max] Length = 187 Score = 131 bits (330), Expect = 2e-28 Identities = 62/80 (77%), Positives = 73/80 (91%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PE+TA+VE GKIKKL+GVKTKELL+W++LS+I+VDDPPTGKITFKTPSGL+R+ Sbjct: 72 GKLVSYAPEITAYVEVGKIKKLTGVKTKELLVWITLSEIFVDDPPTGKITFKTPSGLFRT 131 Query: 62 FPVSAFEIEEKTKENKQGNE 3 FPVSAFEIEE KE K+ E Sbjct: 132 FPVSAFEIEEPVKEVKEKEE 151 >gb|AFK47875.1| unknown [Lotus japonicus] Length = 167 Score = 130 bits (327), Expect = 4e-28 Identities = 66/83 (79%), Positives = 72/83 (86%), Gaps = 7/83 (8%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSYGPEVTA VE GKIKKL+GVKTKELLLWVSLSDIY D+PPTGKITFKTP+GLYRS Sbjct: 72 GKLVSYGPEVTAQVEKGKIKKLTGVKTKELLLWVSLSDIYTDEPPTGKITFKTPAGLYRS 131 Query: 62 FPVSAFEI-------EEKTKENK 15 FPVSAFEI EEK+K ++ Sbjct: 132 FPVSAFEIVEEKSCVEEKSKNHE 154 >ref|XP_010024143.1| PREDICTED: uncharacterized protein LOC104414683 [Eucalyptus grandis] Length = 164 Score = 130 bits (326), Expect = 5e-28 Identities = 60/74 (81%), Positives = 68/74 (91%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GK V+Y PE+TA +EHGKIKKL+GVKTKELL+WV+L DIY+DDPPTGKITFKTPSGLYRS Sbjct: 72 GKPVTYAPEITAQIEHGKIKKLTGVKTKELLVWVTLCDIYLDDPPTGKITFKTPSGLYRS 131 Query: 62 FPVSAFEIEEKTKE 21 FPVSAFEIEE K+ Sbjct: 132 FPVSAFEIEEPAKD 145 >ref|XP_007206043.1| hypothetical protein PRUPE_ppa012574mg [Prunus persica] gi|462401685|gb|EMJ07242.1| hypothetical protein PRUPE_ppa012574mg [Prunus persica] Length = 163 Score = 129 bits (325), Expect = 7e-28 Identities = 62/75 (82%), Positives = 70/75 (93%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA+VE+GKIKKL+GVKTKELL+WVSLSDIYVDDPPTGKITFKTPSGL+R+ Sbjct: 73 GKLVSYAPEVTAYVENGKIKKLTGVKTKELLVWVSLSDIYVDDPPTGKITFKTPSGLFRT 132 Query: 62 FPVSAFEIEEKTKEN 18 FPVSAFE EE ++ Sbjct: 133 FPVSAFENEEAANKD 147 >gb|KRH68428.1| hypothetical protein GLYMA_03G230600 [Glycine max] Length = 165 Score = 129 bits (324), Expect = 9e-28 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTAHV+ GKI KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL+RS Sbjct: 73 GKLVSYAPEVTAHVQQGKITKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLFRS 132 Query: 62 FPVSAFEIEEK 30 FPVSAFEI+E+ Sbjct: 133 FPVSAFEIQEE 143 >gb|KHN03925.1| hypothetical protein glysoja_022611 [Glycine soja] Length = 121 Score = 129 bits (324), Expect = 9e-28 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTAHV+ GKI KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL+RS Sbjct: 29 GKLVSYAPEVTAHVQQGKITKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLFRS 88 Query: 62 FPVSAFEIEEK 30 FPVSAFEI+E+ Sbjct: 89 FPVSAFEIQEE 99 >ref|NP_001238325.1| uncharacterized protein LOC100306660 [Glycine max] gi|255629209|gb|ACU14949.1| unknown [Glycine max] Length = 165 Score = 129 bits (324), Expect = 9e-28 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTAHV+ GKI KL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL+RS Sbjct: 73 GKLVSYAPEVTAHVQQGKITKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLFRS 132 Query: 62 FPVSAFEIEEK 30 FPVSAFEI+E+ Sbjct: 133 FPVSAFEIQEE 143 >ref|XP_008246159.1| PREDICTED: uncharacterized protein LOC103344327 [Prunus mume] Length = 204 Score = 129 bits (323), Expect = 1e-27 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA+VE GKIKKL+GVKTKELL+WVSLSDIYVDDPPTGKITFKTPSGL+R+ Sbjct: 114 GKLVSYAPEVTAYVEKGKIKKLTGVKTKELLVWVSLSDIYVDDPPTGKITFKTPSGLFRT 173 Query: 62 FPVSAFEIEEKTKEN 18 FPVSAFE EE ++ Sbjct: 174 FPVSAFEKEEAANKD 188 >ref|XP_007031193.1| Uncharacterized protein TCM_026789 [Theobroma cacao] gi|508719798|gb|EOY11695.1| Uncharacterized protein TCM_026789 [Theobroma cacao] Length = 166 Score = 128 bits (322), Expect = 1e-27 Identities = 67/87 (77%), Positives = 71/87 (81%), Gaps = 7/87 (8%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA VE KIKKL+GVKTKELLLW++LSDIYVDDPPTGKITFKTP+GL RS Sbjct: 73 GKLVSYAPEVTAVVEQSKIKKLTGVKTKELLLWITLSDIYVDDPPTGKITFKTPAGLSRS 132 Query: 62 FPVSAFEIE-------EKTKENKQGNE 3 FPVSAFEIE EK KE K NE Sbjct: 133 FPVSAFEIEGEVKDAKEKKKEEKDVNE 159 >ref|XP_004494532.1| PREDICTED: uncharacterized protein LOC101506609 [Cicer arietinum] Length = 152 Score = 128 bits (321), Expect = 2e-27 Identities = 57/70 (81%), Positives = 68/70 (97%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY EVTAHVEHGKIKKL+GVKTKE+L+W++LSDIY+D+PPTGKITFKTPSGLY++ Sbjct: 72 GKLVSYATEVTAHVEHGKIKKLNGVKTKEILVWITLSDIYIDNPPTGKITFKTPSGLYKT 131 Query: 62 FPVSAFEIEE 33 FPVSAFE+E+ Sbjct: 132 FPVSAFEVED 141 >ref|XP_008370369.1| PREDICTED: uncharacterized protein LOC103433861 [Malus domestica] gi|658020415|ref|XP_008345587.1| PREDICTED: uncharacterized protein LOC103408523 [Malus domestica] Length = 165 Score = 127 bits (318), Expect = 4e-27 Identities = 61/74 (82%), Positives = 67/74 (90%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA VE GKIKKL+GVKTKELL+WV LSDIYVDDPPTGKITFKTP+GL+R+ Sbjct: 74 GKLVSYAPEVTAIVEKGKIKKLTGVKTKELLVWVQLSDIYVDDPPTGKITFKTPAGLFRT 133 Query: 62 FPVSAFEIEEKTKE 21 FPVSAFE+EE E Sbjct: 134 FPVSAFEVEESACE 147 >ref|XP_009337639.1| PREDICTED: uncharacterized protein LOC103930074 [Pyrus x bretschneideri] Length = 165 Score = 126 bits (317), Expect = 6e-27 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA VE GKIKKL+GVKTKELL+WV LSDIYVDDPPTGKITFKTP+GL+R+ Sbjct: 74 GKLVSYAPEVTAIVEKGKIKKLTGVKTKELLVWVQLSDIYVDDPPTGKITFKTPAGLFRT 133 Query: 62 FPVSAFEIEEKT 27 FPVSAFE+EE + Sbjct: 134 FPVSAFEVEESS 145 >ref|XP_012088865.1| PREDICTED: uncharacterized protein LOC105647410 [Jatropha curcas] gi|643708452|gb|KDP23368.1| hypothetical protein JCGZ_23201 [Jatropha curcas] Length = 162 Score = 126 bits (316), Expect = 7e-27 Identities = 59/77 (76%), Positives = 70/77 (90%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 G+L +Y PEVTA VE GKIKKL+GVKTKELLLWV+LSDIY+DDPPTGKITF+TP+GLYR+ Sbjct: 72 GRLTTYAPEVTAVVEKGKIKKLTGVKTKELLLWVTLSDIYLDDPPTGKITFQTPAGLYRT 131 Query: 62 FPVSAFEIEEKTKENKQ 12 FPVSAFE+EE K+ K+ Sbjct: 132 FPVSAFEVEEPKKDVKE 148 >ref|XP_008388456.1| PREDICTED: uncharacterized protein At5g01610-like [Malus domestica] Length = 166 Score = 125 bits (314), Expect = 1e-26 Identities = 62/82 (75%), Positives = 69/82 (84%), Gaps = 2/82 (2%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKLVSY PEVTA VE GKIKKL+GVKTKELL+WV LSDIY DDPPTGKITFKTPSGL+R+ Sbjct: 74 GKLVSYAPEVTAVVEKGKIKKLTGVKTKELLIWVQLSDIYTDDPPTGKITFKTPSGLFRT 133 Query: 62 FPVSAFEIEEKT--KENKQGNE 3 FPVSAFE+E K+ K+ E Sbjct: 134 FPVSAFEVEXSACGKDGKEKKE 155 >ref|XP_013450442.1| plant/F25P12-18 protein [Medicago truncatula] gi|217071034|gb|ACJ83877.1| unknown [Medicago truncatula] gi|388521237|gb|AFK48680.1| unknown [Medicago truncatula] gi|657380266|gb|KEH24470.1| plant/F25P12-18 protein [Medicago truncatula] Length = 170 Score = 124 bits (312), Expect = 2e-26 Identities = 59/71 (83%), Positives = 67/71 (94%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GK VSY EVTA+VE+GKIKKL+GVKTKELL+WV+L DIY+DDPPTGKITFKTPSGL+RS Sbjct: 72 GKPVSYATEVTAYVENGKIKKLNGVKTKELLIWVTLCDIYIDDPPTGKITFKTPSGLFRS 131 Query: 62 FPVSAFEIEEK 30 FPVSAFEIEE+ Sbjct: 132 FPVSAFEIEEE 142 >ref|XP_002307069.2| hypothetical protein POPTR_0005s01470g [Populus trichocarpa] gi|118484673|gb|ABK94207.1| unknown [Populus trichocarpa] gi|550337725|gb|EEE94065.2| hypothetical protein POPTR_0005s01470g [Populus trichocarpa] Length = 175 Score = 124 bits (312), Expect = 2e-26 Identities = 59/73 (80%), Positives = 67/73 (91%) Frame = -1 Query: 242 GKLVSYGPEVTAHVEHGKIKKLSGVKTKELLLWVSLSDIYVDDPPTGKITFKTPSGLYRS 63 GKL SYG EVTA+VE KIKKL+GVKTKELLLWV+LSDIY+DDPPTGKITF+TP+GLYR+ Sbjct: 72 GKLASYGTEVTAYVEQNKIKKLTGVKTKELLLWVTLSDIYLDDPPTGKITFQTPTGLYRT 131 Query: 62 FPVSAFEIEEKTK 24 FPVSAF +EEK K Sbjct: 132 FPVSAFVVEEKGK 144