BLASTX nr result
ID: Cinnamomum24_contig00036686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036686 (238 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF09374.1| hypothetical protein SEPMUDRAFT_52158 [Sphaerulin... 60 5e-07 >gb|EMF09374.1| hypothetical protein SEPMUDRAFT_52158 [Sphaerulina musiva SO2202] Length = 90 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 129 MASSKFVEHLDTSDAPFSHDNVSLDDILNETRHRSESQTSFSS 1 MA+SKFVE LDT P+S DNVSLDD+L ETR RSESQ S +S Sbjct: 1 MAASKFVEILDTKTTPYSRDNVSLDDVLAETRERSESQGSIAS 43