BLASTX nr result
ID: Cinnamomum24_contig00036668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00036668 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003658574.1| hypothetical protein MYCTH_2294490 [Myceliop... 86 8e-15 gb|EME46352.1| hypothetical protein DOTSEDRAFT_70373 [Dothistrom... 83 7e-14 ref|XP_003656539.1| hypothetical protein THITE_2121299 [Thielavi... 83 7e-14 ref|XP_006696183.1| ubiquitin-like protein [Chaetomium thermophi... 83 9e-14 dbj|GAQ02835.1| deubiquitination-protection protein dph1 [Asperg... 82 1e-13 dbj|GAO88458.1| deubiquitination-protection protein dph1 [Neosar... 82 1e-13 gb|KKY15176.1| putative ubiquitin-like protein [Phaeomoniella ch... 82 1e-13 gb|KKK25761.1| ubiquitin-like protein [Aspergillus rambellii] 82 1e-13 gb|KKK13680.1| ubiquitin-like protein [Aspergillus ochraceoroseus] 82 1e-13 gb|KEY83102.1| ubiquitin DskB [Aspergillus fumigatus var. RP-2014] 82 1e-13 ref|XP_751218.1| ubiquitin-like protein DskB [Aspergillus fumiga... 82 1e-13 ref|XP_001258482.1| ubiquitin-like protein DskB, putative [Neosa... 82 1e-13 gb|KMK63634.1| ubiquitin-like protein DskB [Aspergillus fumigatu... 82 2e-13 gb|KIW43951.1| hypothetical protein PV06_04997 [Exophiala oligos... 82 2e-13 ref|XP_007732768.1| hypothetical protein A1O3_04449 [Capronia ep... 82 2e-13 ref|XP_007726346.1| hypothetical protein A1O1_07284 [Capronia co... 82 2e-13 ref|XP_011126980.1| hypothetical protein AOL_s00193g67 [Arthrobo... 82 2e-13 ref|XP_001212566.1| deubiquitination-protection protein dph1 [As... 82 2e-13 gb|KOP46974.1| Deubiquitination-protection protein dph1 [Madurel... 81 3e-13 emb|CRK14927.1| hypothetical protein BN1723_002096 [Verticillium... 81 3e-13 >ref|XP_003658574.1| hypothetical protein MYCTH_2294490 [Myceliophthora thermophila ATCC 42464] gi|347005841|gb|AEO53329.1| hypothetical protein MYCTH_2294490 [Myceliophthora thermophila ATCC 42464] Length = 445 Score = 86.3 bits (212), Expect = 8e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA+QLR LNDMGFYDFDRNV ALRRSGGSVQGAVEYLLSNP Sbjct: 402 EERYAEQLRQLNDMGFYDFDRNVTALRRSGGSVQGAVEYLLSNP 445 >gb|EME46352.1| hypothetical protein DOTSEDRAFT_70373 [Dothistroma septosporum NZE10] Length = 447 Score = 83.2 bits (204), Expect = 7e-14 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSN 180 EERY QL+SLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSN Sbjct: 405 EERYESQLQSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSN 447 >ref|XP_003656539.1| hypothetical protein THITE_2121299 [Thielavia terrestris NRRL 8126] gi|347003804|gb|AEO70203.1| hypothetical protein THITE_2121299 [Thielavia terrestris NRRL 8126] Length = 446 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA+QLR LNDMGF+DF+RNV ALRRSGGSVQGAVEYLLSNP Sbjct: 403 EERYAEQLRQLNDMGFFDFERNVTALRRSGGSVQGAVEYLLSNP 446 >ref|XP_006696183.1| ubiquitin-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340924335|gb|EGS19238.1| ubiquitin-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 455 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA+QLR LNDMGF+DF+RNV ALRRSGGSVQGA+EYLLSNP Sbjct: 412 EERYAEQLRQLNDMGFFDFERNVAALRRSGGSVQGAIEYLLSNP 455 >dbj|GAQ02835.1| deubiquitination-protection protein dph1 [Aspergillus lentulus] Length = 470 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGAVEYLLS+P Sbjct: 426 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAVEYLLSHP 469 >dbj|GAO88458.1| deubiquitination-protection protein dph1 [Neosartorya udagawae] Length = 471 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGAVEYLLS+P Sbjct: 427 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAVEYLLSHP 470 >gb|KKY15176.1| putative ubiquitin-like protein [Phaeomoniella chlamydospora] Length = 473 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA+QLR LNDMGFYDFDRNVQAL RSGGSVQGA+E+LL NP Sbjct: 430 EERYAEQLRQLNDMGFYDFDRNVQALSRSGGSVQGAIEHLLGNP 473 >gb|KKK25761.1| ubiquitin-like protein [Aspergillus rambellii] Length = 460 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGFY+F+RN++ALRR+GGSVQGAVEYLLS+P Sbjct: 416 EERYADQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLSHP 459 >gb|KKK13680.1| ubiquitin-like protein [Aspergillus ochraceoroseus] Length = 471 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGFY+F+RN++ALRR+GGSVQGAVEYLLS+P Sbjct: 427 EERYADQLRQLNDMGFYEFERNIEALRRAGGSVQGAVEYLLSHP 470 >gb|KEY83102.1| ubiquitin DskB [Aspergillus fumigatus var. RP-2014] Length = 472 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGAVEYLLS+P Sbjct: 428 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAVEYLLSHP 471 >ref|XP_751218.1| ubiquitin-like protein DskB [Aspergillus fumigatus Af293] gi|66848851|gb|EAL89180.1| ubiquitin-like protein DskB, putative [Aspergillus fumigatus Af293] gi|159130327|gb|EDP55440.1| ubiquitin-like protein DskB, putative [Aspergillus fumigatus A1163] Length = 472 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGAVEYLLS+P Sbjct: 428 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAVEYLLSHP 471 >ref|XP_001258482.1| ubiquitin-like protein DskB, putative [Neosartorya fischeri NRRL 181] gi|119406634|gb|EAW16585.1| ubiquitin-like protein DskB, putative [Neosartorya fischeri NRRL 181] Length = 470 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGAVEYLLS+P Sbjct: 426 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAVEYLLSHP 469 >gb|KMK63634.1| ubiquitin-like protein DskB [Aspergillus fumigatus Z5] Length = 472 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RNV+ALRRSGGSVQGA+EYLLS+P Sbjct: 428 EERYADQLRQLNDMGFFEFERNVEALRRSGGSVQGAIEYLLSHP 471 >gb|KIW43951.1| hypothetical protein PV06_04997 [Exophiala oligosperma] Length = 453 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA QL+ LNDMGFYDFDRN+QALRR+GGSV GA+EYLLSNP Sbjct: 410 EERYATQLQQLNDMGFYDFDRNIQALRRTGGSVNGAIEYLLSNP 453 >ref|XP_007732768.1| hypothetical protein A1O3_04449 [Capronia epimyces CBS 606.96] gi|590012285|gb|EXJ87489.1| hypothetical protein A1O3_04449 [Capronia epimyces CBS 606.96] Length = 505 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA QL+ LNDMGFYDFDRN+QALRR+GGSV GA+EYLLSNP Sbjct: 462 EERYATQLQQLNDMGFYDFDRNIQALRRTGGSVNGAIEYLLSNP 505 >ref|XP_007726346.1| hypothetical protein A1O1_07284 [Capronia coronata CBS 617.96] gi|590008453|gb|EXJ83660.1| hypothetical protein A1O1_07284 [Capronia coronata CBS 617.96] Length = 472 Score = 82.0 bits (201), Expect = 2e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA QL+ LNDMGFYDFDRN+QALRR+GGSV GA+EYLLSNP Sbjct: 429 EERYATQLQQLNDMGFYDFDRNIQALRRTGGSVNGAIEYLLSNP 472 >ref|XP_011126980.1| hypothetical protein AOL_s00193g67 [Arthrobotrys oligospora ATCC 24927] gi|345561243|gb|EGX44339.1| hypothetical protein AOL_s00193g67 [Arthrobotrys oligospora ATCC 24927] Length = 491 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYA+QLR LNDMGF+DFDRNV ALRRSGGSVQGA+EYLLS P Sbjct: 448 EERYAEQLRQLNDMGFFDFDRNVAALRRSGGSVQGAIEYLLSGP 491 >ref|XP_001212566.1| deubiquitination-protection protein dph1 [Aspergillus terreus NIH2624] gi|114194962|gb|EAU36662.1| deubiquitination-protection protein dph1 [Aspergillus terreus NIH2624] Length = 469 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSNP 177 EERYADQLR LNDMGF++F+RN++ALRRSGGSVQGAVEYLLS P Sbjct: 426 EERYADQLRQLNDMGFFEFERNIEALRRSGGSVQGAVEYLLSGP 469 >gb|KOP46974.1| Deubiquitination-protection protein dph1 [Madurella mycetomatis] Length = 433 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLS 183 EERYADQLR LNDMGF+DFDRNV ALRRSGGSVQGAVEYLLS Sbjct: 390 EERYADQLRQLNDMGFFDFDRNVTALRRSGGSVQGAVEYLLS 431 >emb|CRK14927.1| hypothetical protein BN1723_002096 [Verticillium longisporum] Length = 274 Score = 81.3 bits (199), Expect = 3e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 308 EERYADQLRSLNDMGFYDFDRNVQALRRSGGSVQGAVEYLLSN 180 EERYADQLR LNDMGFYDFDRNV ALRRSGGSVQGAVE+LLS+ Sbjct: 232 EERYADQLRQLNDMGFYDFDRNVAALRRSGGSVQGAVEHLLSS 274