BLASTX nr result
ID: Cinnamomum24_contig00035908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00035908 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45984.1| hypothetical protein DOTSEDRAFT_70109 [Dothistrom... 75 3e-11 ref|XP_007926418.1| hypothetical protein MYCFIDRAFT_207690 [Pseu... 70 8e-10 >gb|EME45984.1| hypothetical protein DOTSEDRAFT_70109 [Dothistroma septosporum NZE10] Length = 453 Score = 74.7 bits (182), Expect = 3e-11 Identities = 39/56 (69%), Positives = 43/56 (76%) Frame = -2 Query: 169 PVGSGPLVTVDRPWGADRRESFRSGAEGPYNAGAVTQYARRSEGALDRRDESYVSK 2 PV SGPLV + RP A R ESFRSG EGPY AG V QY RRS+GALDR+D SYVS+ Sbjct: 275 PVSSGPLVPMSRP-AATREESFRSGTEGPYGAGTVAQYGRRSDGALDRQD-SYVSR 328 >ref|XP_007926418.1| hypothetical protein MYCFIDRAFT_207690 [Pseudocercospora fijiensis CIRAD86] gi|452983337|gb|EME83095.1| hypothetical protein MYCFIDRAFT_207690 [Pseudocercospora fijiensis CIRAD86] Length = 1449 Score = 69.7 bits (169), Expect = 8e-10 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 7/63 (11%) Frame = -2 Query: 169 PVGSGPLVT-----VDRPWGADRRESFRSGAEGPYNAGAVTQYARRSEGALDRRD--ESY 11 PV +GPLV VDRP+ R +S+RSG + PY AGAVTQY RRS+GALDR ESY Sbjct: 555 PVSAGPLVVRPSTPVDRPYATQRGDSYRSGYDAPYGAGAVTQYGRRSDGALDRSGDRESY 614 Query: 10 VSK 2 VS+ Sbjct: 615 VSR 617