BLASTX nr result
ID: Cinnamomum24_contig00031806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00031806 (285 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|32... 73 7e-11 ref|YP_009045801.1| ribosomal protein L2 (mitochondrion) [Batis ... 73 9e-11 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 73 9e-11 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 73 9e-11 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 73 9e-11 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 73 9e-11 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 73 9e-11 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 73 9e-11 ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochond... 72 2e-10 ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sat... 72 2e-10 sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, m... 72 2e-10 gb|AEK66742.1| ribosomal protein L2 (mitochondrion) [Ferrocalamu... 72 2e-10 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 72 2e-10 gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] 70 6e-10 gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sa... 70 8e-10 ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 69 1e-09 ref|YP_009173847.1| ribosomal protein L2 (mitochondrion) [Populu... 69 2e-09 gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella t... 66 9e-09 ref|XP_009386524.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 65 2e-08 ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossyp... 65 2e-08 >ref|YP_004849339.1| ribosomal protein L2 [Cucumis sativus] gi|325305597|gb|ADZ10766.1| ribosomal protein L2 [Cucumis sativus] Length = 341 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 130 MITRYTMRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MIT T RQS +GRALRQFTLSTGKSAGRNSSGRITVFH GGG Sbjct: 1 MITISTKRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHLGGG 43 >ref|YP_009045801.1| ribosomal protein L2 (mitochondrion) [Batis maritima] gi|655168575|gb|AIC83404.1| ribosomal protein L2 (mitochondrion) (mitochondrion) [Batis maritima] Length = 338 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSKEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026149|dbj|BAI67982.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026205|dbj|BAI68037.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza sativa Indica Group] Length = 504 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS++GRALR FTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|194033244|ref|YP_002000581.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|23495405|dbj|BAC19886.1| Ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100083|gb|AAZ99247.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|74100138|gb|AAZ99301.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100192|gb|AAZ99354.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685231|gb|AER12994.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|353685298|gb|AER13060.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277621|gb|AEZ03727.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277672|gb|AEZ03777.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|528540449|dbj|BAN67503.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540486|dbj|BAN67539.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] Length = 502 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS++GRALR FTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, mitochondrial gi|218547415|sp|P0C8K6.1|RM02_ORYSA RecName: Full=60S ribosomal protein L2, mitochondrial gi|218551750|sp|Q2F969.2|RM02_ORYSI RecName: Full=60S ribosomal protein L2, mitochondrial gi|193240423|dbj|BAA11350.2| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] Length = 502 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS++GRALR FTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >gb|AEK66742.1| ribosomal protein L2 (mitochondrion) [Ferrocalamus rimosivaginus] Length = 345 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS++GRALR FTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSIKGRALRHFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQSL+GRALR FTL+TGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSLKGRALRHFTLNTGKSAGRNSSGRITVFHRGGG 37 >gb|AEN56111.1| ribosomal protein L2 [Cucumis melo subsp. melo] Length = 354 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -3 Query: 130 MITRYTMRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MIT T RQS +GRALRQFTLSTGKSAGRNSSGRITVF GGG Sbjct: 1 MITISTKRQSQEGRALRQFTLSTGKSAGRNSSGRITVFRLGGG 43 >gb|ALF04062.1| ribosomal protein L2 (mitochondrion) [Cannabis sativa] Length = 337 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS + RALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEERALRQFTLSTGKSAGRNSSGRITVFHRGGG 37 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 106 QSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 + LQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 2 RELQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 36 >ref|YP_009173847.1| ribosomal protein L2 (mitochondrion) [Populus tremula] gi|948299279|ref|YP_009178744.1| ribosomal protein L2 (mitochondrion) [Populus tremula x Populus alba] gi|743913265|ref|XP_011000535.1| PREDICTED: 60S ribosomal protein L2, mitochondrial [Populus euphratica] gi|936227477|gb|ALH07311.1| ribosomal protein L2 (mitochondrion) [Populus tremula] gi|938485548|gb|ALJ49767.1| ribosomal protein L2 (mitochondrion) [Populus tremula x Populus alba] Length = 335 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 MRQS +GRALRQFT TGKSAGRNSSGRITVFHRGGG Sbjct: 1 MRQSQEGRALRQFTSRTGKSAGRNSSGRITVFHRGGG 37 >gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella trichopoda] Length = 632 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 100 LQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 L GRALRQFTLSTGKSAGRNSSGRITVFHRGGG Sbjct: 2 LLGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 34 >ref|XP_009386524.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial [Musa acuminata subsp. malaccensis] Length = 378 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 127 ITRYTMRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGGG 2 +TR MRQSL+G ALR FTLS KSAGRNSSGRIT FHRGGG Sbjct: 1 MTRERMRQSLKGGALRHFTLSLRKSAGRNSSGRITSFHRGGG 42 >ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] gi|430728017|gb|AGA54174.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 112 MRQSLQGRALRQFTLSTGKSAGRNSSGRITVFHRGG 5 MRQS + RALRQF LSTGKSAGRNSSGRITVFHRGG Sbjct: 1 MRQSQERRALRQFILSTGKSAGRNSSGRITVFHRGG 36