BLASTX nr result
ID: Cinnamomum24_contig00031454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00031454 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 (mitochondrion) [Daucus carota subsp. ... 117 3e-24 >ref|YP_006291838.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 117 bits (294), Expect = 3e-24 Identities = 60/78 (76%), Positives = 65/78 (83%), Gaps = 2/78 (2%) Frame = +2 Query: 113 MDPIPYIEHSFLSINRKIFVKYRTLPFFFFRNSSYQRQLPTSTPPHTTSWGGAVRLLNQ- 289 MDPIPYIEHSFLSI+RKIFVKYRT P FF+NSSY RQL TSTPPHTTSWGG + Sbjct: 1 MDPIPYIEHSFLSIDRKIFVKYRTFP--FFKNSSYPRQLITSTPPHTTSWGGCSPFESNK 58 Query: 290 -SSRGFIATFILKETEEP 340 SSRGFIATF+LKE+EEP Sbjct: 59 VSSRGFIATFVLKESEEP 76