BLASTX nr result
ID: Cinnamomum24_contig00027965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027965 (495 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010265428.1| PREDICTED: afadin- and alpha-actinin-binding... 87 4e-15 ref|XP_011069917.1| PREDICTED: afadin- and alpha-actinin-binding... 86 8e-15 ref|XP_004242932.1| PREDICTED: afadin- and alpha-actinin-binding... 83 9e-14 ref|XP_009792312.1| PREDICTED: afadin- and alpha-actinin-binding... 80 5e-13 ref|XP_011079295.1| PREDICTED: afadin- and alpha-actinin-binding... 80 6e-13 ref|XP_011623839.1| PREDICTED: afadin- and alpha-actinin-binding... 79 1e-12 gb|ERN07320.1| hypothetical protein AMTR_s00019p00224250 [Ambore... 79 1e-12 ref|XP_010928667.1| PREDICTED: afadin- and alpha-actinin-binding... 78 3e-12 ref|XP_010928665.1| PREDICTED: afadin- and alpha-actinin-binding... 78 3e-12 ref|XP_010913665.1| PREDICTED: afadin- and alpha-actinin-binding... 78 3e-12 ref|XP_010913664.1| PREDICTED: afadin- and alpha-actinin-binding... 78 3e-12 ref|XP_008223693.1| PREDICTED: afadin- and alpha-actinin-binding... 77 7e-12 ref|XP_008223691.1| PREDICTED: afadin- and alpha-actinin-binding... 77 7e-12 ref|XP_011648930.1| PREDICTED: afadin- and alpha-actinin-binding... 76 9e-12 ref|XP_008789666.1| PREDICTED: afadin- and alpha-actinin-binding... 76 9e-12 ref|XP_008451670.1| PREDICTED: afadin- and alpha-actinin-binding... 76 9e-12 ref|XP_008451667.1| PREDICTED: afadin- and alpha-actinin-binding... 76 9e-12 emb|CDP02982.1| unnamed protein product [Coffea canephora] 75 1e-11 ref|XP_012857356.1| PREDICTED: afadin- and alpha-actinin-binding... 75 2e-11 ref|XP_008775936.1| PREDICTED: uncharacterized protein LOC103696... 75 2e-11 >ref|XP_010265428.1| PREDICTED: afadin- and alpha-actinin-binding protein isoform X1 [Nelumbo nucifera] Length = 386 Score = 87.4 bits (215), Expect = 4e-15 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHLAKSE+PRR++GHLD+ERDSILS PAEG Sbjct: 337 EAQLVEARSIIQEQASIMSKHLAKSERPRRVNGHLDSERDSILSLPAEG 385 >ref|XP_011069917.1| PREDICTED: afadin- and alpha-actinin-binding protein [Sesamum indicum] Length = 386 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHLAKSE+PRRLSGHL+++RDS+LS P+EG Sbjct: 337 EAQLVEARSIIQEQASIMSKHLAKSERPRRLSGHLNSDRDSLLSSPSEG 385 >ref|XP_004242932.1| PREDICTED: afadin- and alpha-actinin-binding protein [Solanum lycopersicum] gi|565391755|ref|XP_006361578.1| PREDICTED: centrosomal protein of 83 kDa-like [Solanum tuberosum] Length = 388 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHL KSEKPRRLSGH+++ERD ++S P EG Sbjct: 339 EAQLVEARSIIQEQASIMSKHLTKSEKPRRLSGHMNSERDLLISSPTEG 387 >ref|XP_009792312.1| PREDICTED: afadin- and alpha-actinin-binding protein-like [Nicotiana sylvestris] Length = 399 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKHL KSEKPRRLSGH+++ERD ++S P E Sbjct: 339 EAQLVEARSIIQEQASIMSKHLTKSEKPRRLSGHMNSERDLLISSPTE 386 >ref|XP_011079295.1| PREDICTED: afadin- and alpha-actinin-binding protein-like [Sesamum indicum] Length = 385 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGP 358 EAQLVEARSIIQEQAS+MSKHLAKSE+PRRLSGHL ++RDSILS P Sbjct: 337 EAQLVEARSIIQEQASMMSKHLAKSERPRRLSGHLSSDRDSILSPP 382 >ref|XP_011623839.1| PREDICTED: afadin- and alpha-actinin-binding protein [Amborella trichopoda] Length = 418 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEGA*FSDG 331 EAQLVEARSIIQEQASIMSKHL+KSE PRRL GHLD +R++ILS P E S G Sbjct: 337 EAQLVEARSIIQEQASIMSKHLSKSENPRRLMGHLDVDREAILSTPVEDRSASHG 391 >gb|ERN07320.1| hypothetical protein AMTR_s00019p00224250 [Amborella trichopoda] Length = 421 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEGA*FSDG 331 EAQLVEARSIIQEQASIMSKHL+KSE PRRL GHLD +R++ILS P E S G Sbjct: 337 EAQLVEARSIIQEQASIMSKHLSKSENPRRLMGHLDVDREAILSTPVEDRSASHG 391 >ref|XP_010928667.1| PREDICTED: afadin- and alpha-actinin-binding protein-like isoform X3 [Elaeis guineensis] Length = 431 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKHL KSEKPRRLS HLDAER+ I S AE Sbjct: 382 EAQLVEARSIIQEQASIMSKHLTKSEKPRRLSSHLDAEREVIHSASAE 429 >ref|XP_010928665.1| PREDICTED: afadin- and alpha-actinin-binding protein-like isoform X1 [Elaeis guineensis] Length = 436 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKHL KSEKPRRLS HLDAER+ I S AE Sbjct: 382 EAQLVEARSIIQEQASIMSKHLTKSEKPRRLSSHLDAEREVIHSASAE 429 >ref|XP_010913665.1| PREDICTED: afadin- and alpha-actinin-binding protein isoform X2 [Elaeis guineensis] Length = 386 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKH AKSEKPR LSGHLDAER+ I S AE Sbjct: 337 EAQLVEARSIIQEQASIMSKHFAKSEKPRILSGHLDAEREGIHSASAE 384 >ref|XP_010913664.1| PREDICTED: afadin- and alpha-actinin-binding protein isoform X1 [Elaeis guineensis] Length = 391 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKH AKSEKPR LSGHLDAER+ I S AE Sbjct: 337 EAQLVEARSIIQEQASIMSKHFAKSEKPRILSGHLDAEREGIHSASAE 384 >ref|XP_008223693.1| PREDICTED: afadin- and alpha-actinin-binding protein isoform X3 [Prunus mume] Length = 321 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSK LAKSE+PR L+GH ++ R+SI+S PAEG Sbjct: 270 EAQLVEARSIIQEQASIMSKQLAKSERPRNLNGHFNSGRESIISSPAEG 318 >ref|XP_008223691.1| PREDICTED: afadin- and alpha-actinin-binding protein A isoform X1 [Prunus mume] Length = 388 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSK LAKSE+PR L+GH ++ R+SI+S PAEG Sbjct: 337 EAQLVEARSIIQEQASIMSKQLAKSERPRNLNGHFNSGRESIISSPAEG 385 >ref|XP_011648930.1| PREDICTED: afadin- and alpha-actinin-binding protein-like isoform X1 [Cucumis sativus] gi|700206023|gb|KGN61142.1| hypothetical protein Csa_2G059730 [Cucumis sativus] Length = 394 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHLAKSE+PR L+G D+ R+SI+S P EG Sbjct: 337 EAQLVEARSIIQEQASIMSKHLAKSERPRNLNGPFDSGRESIISSPTEG 385 >ref|XP_008789666.1| PREDICTED: afadin- and alpha-actinin-binding protein-like [Phoenix dactylifera] Length = 385 Score = 76.3 bits (186), Expect = 9e-12 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKH KSEKPRRLS HLDAER+ I S AE Sbjct: 336 EAQLVEARSIIQEQASIMSKHFTKSEKPRRLSSHLDAEREVIHSASAE 383 >ref|XP_008451670.1| PREDICTED: afadin- and alpha-actinin-binding protein-like isoform X2 [Cucumis melo] Length = 394 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHLAKSE+PR L+G D+ R+SI+S P EG Sbjct: 337 EAQLVEARSIIQEQASIMSKHLAKSERPRNLNGPFDSGRESIISSPTEG 385 >ref|XP_008451667.1| PREDICTED: afadin- and alpha-actinin-binding protein A-like isoform X1 [Cucumis melo] Length = 402 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQASIMSKHLAKSE+PR L+G D+ R+SI+S P EG Sbjct: 345 EAQLVEARSIIQEQASIMSKHLAKSERPRNLNGPFDSGRESIISSPTEG 393 >emb|CDP02982.1| unnamed protein product [Coffea canephora] Length = 387 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKHL KSE+PRRLSG+++++R+ ILS P E Sbjct: 339 EAQLVEARSIIQEQASIMSKHLTKSERPRRLSGNINSDRELILSSPTE 386 >ref|XP_012857356.1| PREDICTED: afadin- and alpha-actinin-binding protein-like [Erythranthe guttatus] Length = 387 Score = 74.7 bits (182), Expect = 2e-11 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKP-RRLSGHLDAERDSILSGPAEG 349 EAQLVEARSIIQEQAS+MSKHLAKSE+P RRLSGH+ ++RDSI+ +EG Sbjct: 337 EAQLVEARSIIQEQASVMSKHLAKSERPSRRLSGHMSSDRDSIMLSQSEG 386 >ref|XP_008775936.1| PREDICTED: uncharacterized protein LOC103696174 [Phoenix dactylifera] Length = 139 Score = 74.7 bits (182), Expect = 2e-11 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = -1 Query: 495 EAQLVEARSIIQEQASIMSKHLAKSEKPRRLSGHLDAERDSILSGPAE 352 EAQLVEARSIIQEQASIMSKH AKSEKPR LS HLDAER+ I S AE Sbjct: 90 EAQLVEARSIIQEQASIMSKHFAKSEKPRILSSHLDAEREVIHSASAE 137