BLASTX nr result
ID: Cinnamomum24_contig00027856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027856 (311 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008801174.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 >ref|XP_008801174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Phoenix dactylifera] Length = 622 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = -3 Query: 171 KKPSSIPSTELGLLLQTCIETKSYQQGKSIHSQILKLGFERNRDLLPKLIKFYSVCG 1 K I S E G+LLQ+CI+ +S++QGK +HS+I + GFE+NRDLLPKL+K YSVCG Sbjct: 38 KNCQPITSAEFGVLLQSCIDVRSFEQGKRLHSRIREAGFEKNRDLLPKLVKLYSVCG 94