BLASTX nr result
ID: Cinnamomum24_contig00027693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027693 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGI48779.1| cytochrome c biogenesis B (mitochondrion) [Lolium... 67 4e-09 sp|P93280.2|CCMB_ARATH RecName: Full=Putative cytochrome c bioge... 62 2e-07 ref|YP_717148.1| cytochrome c biogenesis ccmB [Brassica napus] g... 62 2e-07 gb|ABB02055.1| ccb206 [Brassica oleracea] 59 1e-06 gb|AHA47099.1| cytochrome c biogenesis B (mitochondrion) [Ambore... 58 2e-06 ref|YP_002000599.1| cytochrome c biogenesis B (mitochondrion) [O... 58 3e-06 gb|AAC64369.1| ABC transporter CcbB (mitochondrion) [Triticum ae... 58 3e-06 pir||S78218 probable heme transport protein - evening primrose m... 57 5e-06 ref|YP_008802498.1| cytochrome c biogenesis B (mitochondrion) (m... 57 5e-06 dbj|BAD83549.2| cytochrome c maturation protein CcmB (mitochondr... 57 5e-06 ref|NP_064031.2| ccb206 gene product (mitochondrion) [Beta vulga... 57 5e-06 >gb|AGI48779.1| cytochrome c biogenesis B (mitochondrion) [Lolium perenne] Length = 216 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -2 Query: 128 MN*KERRSKEMRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MN KERRSKEMRRLF E F+K IF STPITSF+LFL YIVVT Sbjct: 1 MNSKERRSKEMRRLFLEQFHKQIFPSTPITSFFLFLSYIVVT 42 >sp|P93280.2|CCMB_ARATH RecName: Full=Putative cytochrome c biogenesis ccmB-like mitochondrial protein; AltName: Full=ABC transporter I family member 2; Short=ABC transporter ABCI.2; Short=AtABCI2 Length = 206 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLFFEL+YKLIFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFFELYYKLIFSSTPITSFSLFLLYIVVT 32 >ref|YP_717148.1| cytochrome c biogenesis ccmB [Brassica napus] gi|37591095|dbj|BAC98897.1| cytochrome c biogenesis ccmB [Brassica napus] Length = 206 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLFFEL+YKLIFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFFELYYKLIFSSTPITSFSLFLLYIVVT 32 >gb|ABB02055.1| ccb206 [Brassica oleracea] Length = 205 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF EL+YKLIFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFLELYYKLIFSSTPITSFSLFLLYIVVT 32 >gb|AHA47099.1| cytochrome c biogenesis B (mitochondrion) [Amborella trichopoda] Length = 206 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF ELFYKL STPITSFYLFLLYIVVT Sbjct: 1 MRRLFLELFYKLFLPSTPITSFYLFLLYIVVT 32 >ref|YP_002000599.1| cytochrome c biogenesis B (mitochondrion) [Oryza sativa Japonica Group] gi|60498754|dbj|BAC19903.2| Cytochrome c biogenesis B (mitochondrion) [Oryza sativa Japonica Group] Length = 206 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF E FYK IFSSTPITSF+LFLLYIVVT Sbjct: 1 MRRLFLEQFYKQIFSSTPITSFFLFLLYIVVT 32 >gb|AAC64369.1| ABC transporter CcbB (mitochondrion) [Triticum aestivum] gi|3435250|gb|AAC32374.1| ABC transporter CcbB (mitochondrion) [Triticum aestivum] Length = 206 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF E FYK IFSSTPITSF+LFLLYIVVT Sbjct: 1 MRRLFLEQFYKQIFSSTPITSFFLFLLYIVVT 32 >pir||S78218 probable heme transport protein - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF EL+YK IFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVT 32 >ref|YP_008802498.1| cytochrome c biogenesis B (mitochondrion) (mitochondrion) [Asclepias syriaca] gi|556562337|gb|AGZ63033.1| cytochrome c biogenesis B (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF EL+YK IFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVT 32 >dbj|BAD83549.2| cytochrome c maturation protein CcmB (mitochondrion) [Nicotiana tabacum] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLF EL+YK IFSSTPITSF LFLLYIVVT Sbjct: 1 MRRLFLELYYKQIFSSTPITSFSLFLLYIVVT 32 >ref|NP_064031.2| ccb206 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435056|ref|YP_004222274.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|346683149|ref|YP_004842081.1| cytochrome c maturation protein CcmB [Beta macrocarpa] gi|87248017|gb|ABD36061.1| cytochrome c biogenesis B (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|148491420|dbj|BAA99342.2| cytochrome c biogenesis protein (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905709|emb|CBJ14097.1| cytochrome c biogenesis [Beta vulgaris subsp. maritima] gi|319439789|emb|CBJ17506.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|320148724|emb|CBJ23362.1| cytochrome c maturation protein CcmB [Beta vulgaris subsp. maritima] gi|345500067|emb|CBX24883.1| cytochrome c maturation protein CcmB [Beta macrocarpa] gi|384939201|emb|CBL52048.1| cytochrome c maturation protein CcmB (mitochondrion) [Beta vulgaris subsp. maritima] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 98 MRRLFFELFYKLIFSSTPITSFYLFLLYIVVT 3 MRRLFFEL+YK IF STPITSF LFLLYIVVT Sbjct: 1 MRRLFFELYYKQIFFSTPITSFSLFLLYIVVT 32