BLASTX nr result
ID: Cinnamomum24_contig00027669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00027669 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012086653.1| PREDICTED: transcription factor bHLH157 isof... 62 2e-07 ref|XP_007039441.1| Serine/threonine-protein kinase WNK-related,... 57 4e-06 ref|XP_007039440.1| Serine/threonine-protein kinase WNK-related,... 57 4e-06 ref|XP_007039438.1| Serine/threonine-protein kinase WNK-related,... 57 4e-06 >ref|XP_012086653.1| PREDICTED: transcription factor bHLH157 isoform X1 [Jatropha curcas] gi|643711811|gb|KDP25239.1| hypothetical protein JCGZ_20395 [Jatropha curcas] Length = 864 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = -2 Query: 386 MGSHLKEALQSLCCSNGWSYAVVWRLKCHDSMLPIPVDAYCDVESGMXXXXXXXXXXXVG 207 MGS LKE L+SLCCSNGWSY V WRL +SML DAY + E G +G Sbjct: 1 MGSVLKETLKSLCCSNGWSYGVFWRLDQRNSMLLTMEDAYYEEEMGAAVNNMLLQAHMLG 60 Query: 206 EG 201 EG Sbjct: 61 EG 62 >ref|XP_007039441.1| Serine/threonine-protein kinase WNK-related, putative isoform 4 [Theobroma cacao] gi|508776686|gb|EOY23942.1| Serine/threonine-protein kinase WNK-related, putative isoform 4 [Theobroma cacao] Length = 801 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = -2 Query: 395 EEKMGSHLKEALQSLCCSNGWSYAVVWRLKCHDSMLPIPVDAYCDVESG 249 E +MGS LK+ L++LCCSNGWSY V WR +SML DAY + + G Sbjct: 3 EAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMG 51 >ref|XP_007039440.1| Serine/threonine-protein kinase WNK-related, putative isoform 3 [Theobroma cacao] gi|508776685|gb|EOY23941.1| Serine/threonine-protein kinase WNK-related, putative isoform 3 [Theobroma cacao] Length = 800 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = -2 Query: 395 EEKMGSHLKEALQSLCCSNGWSYAVVWRLKCHDSMLPIPVDAYCDVESG 249 E +MGS LK+ L++LCCSNGWSY V WR +SML DAY + + G Sbjct: 3 EAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMG 51 >ref|XP_007039438.1| Serine/threonine-protein kinase WNK-related, putative isoform 1 [Theobroma cacao] gi|590675407|ref|XP_007039439.1| Serine/threonine-protein kinase WNK-related, putative isoform 1 [Theobroma cacao] gi|508776683|gb|EOY23939.1| Serine/threonine-protein kinase WNK-related, putative isoform 1 [Theobroma cacao] gi|508776684|gb|EOY23940.1| Serine/threonine-protein kinase WNK-related, putative isoform 1 [Theobroma cacao] Length = 843 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = -2 Query: 395 EEKMGSHLKEALQSLCCSNGWSYAVVWRLKCHDSMLPIPVDAYCDVESG 249 E +MGS LK+ L++LCCSNGWSY V WR +SML DAY + + G Sbjct: 3 EAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMG 51