BLASTX nr result
ID: Cinnamomum24_contig00025376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025376 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010270642.1| PREDICTED: pentatricopeptide repeat-containi... 93 7e-17 ref|XP_008445307.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_008231644.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-15 ref|XP_014506138.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 gb|KOM32902.1| hypothetical protein LR48_Vigan01g245800 [Vigna a... 85 2e-14 ref|XP_006594225.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_004142988.2| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 gb|KGN62280.1| hypothetical protein Csa_2G348180 [Cucumis sativus] 84 3e-14 ref|XP_010061133.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_002318942.2| pentatricopeptide repeat-containing family p... 84 5e-14 ref|XP_008806000.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 ref|XP_007154904.1| hypothetical protein PHAVU_003G157500g [Phas... 83 9e-14 ref|XP_007154903.1| hypothetical protein PHAVU_003G157500g [Phas... 83 9e-14 ref|XP_009370649.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_012465205.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_010526111.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_012073703.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 ref|XP_010932176.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_002510620.1| pentatricopeptide repeat-containing protein,... 79 2e-12 ref|XP_002284799.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 >ref|XP_010270642.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Nelumbo nucifera] Length = 714 Score = 93.2 bits (230), Expect = 7e-17 Identities = 43/73 (58%), Positives = 53/73 (72%) Frame = -2 Query: 220 SRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFD 41 SR+ F LL +TE K LH GR LHA ++K+GL S F+ N LVN YAKCGHL QA L F+ Sbjct: 5 SRSFFTSLLHFTEQKNLHNGRTLHAQIVKSGLGSDLFLANSLVNYYAKCGHLVQAQLQFE 64 Query: 40 EMPYRDVVSWNCL 2 E+ +DV+SWNCL Sbjct: 65 EIDNKDVISWNCL 77 >ref|XP_008445307.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Cucumis melo] gi|659089062|ref|XP_008445308.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Cucumis melo] Length = 710 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/72 (56%), Positives = 54/72 (75%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R+ F+LLL+YT K L KG+A+HA +L+TG ++TN LVNLYAKCG L +A LVF+ Sbjct: 11 RSFFDLLLRYTRQKDLQKGKAIHAQLLRTGSCCSVYLTNSLVNLYAKCGSLLKAKLVFES 70 Query: 37 MPYRDVVSWNCL 2 + +DVVSWNCL Sbjct: 71 ISNKDVVSWNCL 82 >ref|XP_008231644.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Prunus mume] Length = 708 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/80 (53%), Positives = 55/80 (68%) Frame = -2 Query: 241 LMSSTSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLH 62 L S S R+ F L+QY+ K L KG+ALHA ++KTG S ++ N LVNLYAKCG L Sbjct: 3 LSSLPSQYRSLFTTLIQYSRQKDLQKGKALHAQIIKTGPNSCVYIANSLVNLYAKCGDLP 62 Query: 61 QALLVFDEMPYRDVVSWNCL 2 +A LVF+ +P +DVVSWN L Sbjct: 63 KAKLVFEAIPDKDVVSWNSL 82 >ref|XP_014506138.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Vigna radiata var. radiata] Length = 731 Score = 86.3 bits (212), Expect = 8e-15 Identities = 36/65 (55%), Positives = 48/65 (73%) Frame = -2 Query: 196 LQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDEMPYRDVV 17 L+YT +K+L +GR LHA +L+ G S T + N L+NLY KCGH QA LVFD + ++DV+ Sbjct: 17 LRYTVNKELRRGRVLHARILRNGFFSFTHIANALINLYTKCGHFTQANLVFDNIVHKDVI 76 Query: 16 SWNCL 2 SWNCL Sbjct: 77 SWNCL 81 >gb|KOM32902.1| hypothetical protein LR48_Vigan01g245800 [Vigna angularis] Length = 731 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -2 Query: 199 LLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDEMPYRDV 20 LL YT +K+L +GR LHA +L+ G S T + N +NLY KCGH +A LVFD + ++DV Sbjct: 16 LLHYTVNKELRRGRVLHARILRNGFFSFTHIANAFINLYTKCGHFAEANLVFDNIVHKDV 75 Query: 19 VSWNCL 2 +SWNCL Sbjct: 76 ISWNCL 81 >ref|XP_006594225.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like isoform X1 [Glycine max] gi|947071185|gb|KRH20076.1| hypothetical protein GLYMA_13G154700 [Glycine max] gi|947071186|gb|KRH20077.1| hypothetical protein GLYMA_13G154700 [Glycine max] gi|947071187|gb|KRH20078.1| hypothetical protein GLYMA_13G154700 [Glycine max] gi|947071188|gb|KRH20079.1| hypothetical protein GLYMA_13G154700 [Glycine max] Length = 735 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/66 (59%), Positives = 47/66 (71%) Frame = -2 Query: 199 LLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDEMPYRDV 20 L+ T HK+L KGRALHA +L TG S T + N L+NLYAKC H +A LVFD + +DV Sbjct: 17 LVHCTRHKQLRKGRALHARILVTGSFSSTQIANSLINLYAKCSHFSKANLVFDSINNKDV 76 Query: 19 VSWNCL 2 VSWNCL Sbjct: 77 VSWNCL 82 >ref|XP_004142988.2| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Cucumis sativus] Length = 710 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/72 (54%), Positives = 53/72 (73%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R+ +LLL+ T K L KG+A+HA +L+TG S ++TN LVNLYAKCG + +A LVF+ Sbjct: 11 RSFVDLLLRCTRQKDLQKGKAIHAQLLRTGSFSSVYLTNSLVNLYAKCGSIVKAKLVFES 70 Query: 37 MPYRDVVSWNCL 2 + +DVVSWNCL Sbjct: 71 ITNKDVVSWNCL 82 >gb|KGN62280.1| hypothetical protein Csa_2G348180 [Cucumis sativus] Length = 795 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/72 (54%), Positives = 53/72 (73%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R+ +LLL+ T K L KG+A+HA +L+TG S ++TN LVNLYAKCG + +A LVF+ Sbjct: 96 RSFVDLLLRCTRQKDLQKGKAIHAQLLRTGSFSSVYLTNSLVNLYAKCGSIVKAKLVFES 155 Query: 37 MPYRDVVSWNCL 2 + +DVVSWNCL Sbjct: 156 ITNKDVVSWNCL 167 >ref|XP_010061133.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Eucalyptus grandis] Length = 721 Score = 84.0 bits (206), Expect = 4e-14 Identities = 38/72 (52%), Positives = 53/72 (73%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R+ FN L++ T+ K L G++LHA +++TG + T++ NGL+N YAKCG L +A LVFD Sbjct: 9 RSVFNALVECTQQKDLRGGQSLHARLVRTGASAVTYLANGLINFYAKCGRLDKAELVFDG 68 Query: 37 MPYRDVVSWNCL 2 + RDVVSWNCL Sbjct: 69 VADRDVVSWNCL 80 >ref|XP_002318942.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550324648|gb|EEE94865.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 707 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/74 (50%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = -2 Query: 220 SRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSH-TFVTNGLVNLYAKCGHLHQALLVF 44 +R+ +NLL+QY + K L KG+ LHAH++K LS ++ N L+ YAKCGHLH A LVF Sbjct: 7 NRSFYNLLIQYADQKSLKKGQILHAHIIKIPYLSSCNYLANNLIKFYAKCGHLHGAKLVF 66 Query: 43 DEMPYRDVVSWNCL 2 + + +++VVS+NCL Sbjct: 67 ENLKHKNVVSYNCL 80 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/79 (35%), Positives = 44/79 (55%) Frame = -2 Query: 238 MSSTSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQ 59 ++ S+ +AC NL L +G+ +HA +K GL + + L +YAKCG L + Sbjct: 416 LTMASVLKACSNLAA-------LEQGKQIHARTIKYGLGPELSIRSALSTMYAKCGSLEE 468 Query: 58 ALLVFDEMPYRDVVSWNCL 2 +L+F M RD+VSWN + Sbjct: 469 GVLIFRRMLQRDIVSWNAM 487 >ref|XP_008806000.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Phoenix dactylifera] Length = 745 Score = 82.8 bits (203), Expect = 9e-14 Identities = 38/77 (49%), Positives = 50/77 (64%) Frame = -2 Query: 232 STSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQAL 53 + + S+ F LLL+ E K L G +LHAH++K+G +H + N +VN+YAKCG L A Sbjct: 17 AAATSQTLFRLLLRCAEQKNLQSGSSLHAHIIKSGSWAHVLLANSVVNMYAKCGRLATAA 76 Query: 52 LVFDEMPYRDVVSWNCL 2 FDEM RDVVSWN L Sbjct: 77 AAFDEMHSRDVVSWNSL 93 >ref|XP_007154904.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris] gi|561028258|gb|ESW26898.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris] Length = 725 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/66 (56%), Positives = 49/66 (74%) Frame = -2 Query: 199 LLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDEMPYRDV 20 LL T +K+L +GR LHA +L+ G S T + N ++NLYAKCGHL +A LVFD + ++DV Sbjct: 16 LLHCTVNKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLVFDNIVHKDV 75 Query: 19 VSWNCL 2 VSWNCL Sbjct: 76 VSWNCL 81 >ref|XP_007154903.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris] gi|561028257|gb|ESW26897.1| hypothetical protein PHAVU_003G157500g [Phaseolus vulgaris] Length = 732 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/66 (56%), Positives = 49/66 (74%) Frame = -2 Query: 199 LLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDEMPYRDV 20 LL T +K+L +GR LHA +L+ G S T + N ++NLYAKCGHL +A LVFD + ++DV Sbjct: 16 LLHCTVNKELSRGRVLHARILRDGSFSFTHLANAVINLYAKCGHLAEANLVFDNIVHKDV 75 Query: 19 VSWNCL 2 VSWNCL Sbjct: 76 VSWNCL 81 >ref|XP_009370649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Pyrus x bretschneideri] Length = 708 Score = 82.0 bits (201), Expect = 2e-13 Identities = 38/72 (52%), Positives = 49/72 (68%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R F + QY K L KG++LHAH++K G +S ++ N +VNLYAKCG L A LVFD Sbjct: 12 RPLFAAVTQYARQKDLQKGKSLHAHLIKAGSISCVYIANAVVNLYAKCGDLPGAHLVFDA 71 Query: 37 MPYRDVVSWNCL 2 +P +DVVSWN L Sbjct: 72 IPDKDVVSWNSL 83 >ref|XP_012465205.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Gossypium raimondii] gi|763746902|gb|KJB14341.1| hypothetical protein B456_002G120300 [Gossypium raimondii] Length = 714 Score = 80.5 bits (197), Expect = 5e-13 Identities = 37/72 (51%), Positives = 50/72 (69%) Frame = -2 Query: 217 RACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFDE 38 R+CF+ L+Q T+ K L +GRA+HA ++K G +++N LVNLY KCG L A VFD Sbjct: 7 RSCFSELVQCTKQKNLLRGRAVHARIVKDGSACCVYLSNSLVNLYVKCGDLFHAKRVFDN 66 Query: 37 MPYRDVVSWNCL 2 + +DVVSWNCL Sbjct: 67 IQDKDVVSWNCL 78 >ref|XP_010526111.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Tarenaya hassleriana] Length = 720 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/79 (50%), Positives = 53/79 (67%) Frame = -2 Query: 238 MSSTSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQ 59 M+ S + FN L QY++ L GRA+HA +++TG S F+ N LVNLYAKCG+L + Sbjct: 1 MTLPQTSGSLFNQLSQYSQQGNLSAGRAVHARIIRTGSSSCLFLANSLVNLYAKCGNLGK 60 Query: 58 ALLVFDEMPYRDVVSWNCL 2 A LVFD + +DVVSWN L Sbjct: 61 AQLVFDAITDKDVVSWNSL 79 >ref|XP_012073703.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Jatropha curcas] gi|643728919|gb|KDP36856.1| hypothetical protein JCGZ_08147 [Jatropha curcas] Length = 707 Score = 80.5 bits (197), Expect = 5e-13 Identities = 36/73 (49%), Positives = 51/73 (69%) Frame = -2 Query: 220 SRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFD 41 SR+ FN +L+ T K L +GRALH ++K+ S ++ N LVN YAKCG+L +A LVF+ Sbjct: 7 SRSLFNSILECTHQKSLQRGRALHGQIIKSASSSCIYLANSLVNFYAKCGNLPKAKLVFE 66 Query: 40 EMPYRDVVSWNCL 2 + +DV+SWNCL Sbjct: 67 RIRDKDVISWNCL 79 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/79 (39%), Positives = 44/79 (55%) Frame = -2 Query: 238 MSSTSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQ 59 ++ S+ +AC +L L +GR +HA +K GL + + L +YAKCG L + Sbjct: 414 LTMASVLKACSSLAA-------LDQGRQIHARTIKYGLSLAVPIGSALSTMYAKCGSLEE 466 Query: 58 ALLVFDEMPYRDVVSWNCL 2 LVF MP RDVVSWN + Sbjct: 467 GTLVFRRMPERDVVSWNAM 485 >ref|XP_010932176.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Elaeis guineensis] gi|743821970|ref|XP_010932177.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Elaeis guineensis] Length = 724 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/77 (46%), Positives = 49/77 (63%) Frame = -2 Query: 232 STSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQAL 53 + + S+ F LLL+ E K L G ++HAH++K+G +H + N +V +YAKCGHL A Sbjct: 17 AVATSQTLFRLLLRCAEQKNLQSGSSIHAHIIKSGSWAHVLLANSVVIMYAKCGHLATAA 76 Query: 52 LVFDEMPYRDVVSWNCL 2 FD M RDVVSWN L Sbjct: 77 AAFDAMRSRDVVSWNSL 93 >ref|XP_002510620.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551321|gb|EEF52807.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 708 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 1/70 (1%) Frame = -2 Query: 208 FNLLLQYTEHKKLHKGRALHAHVLKTGLLSHT-FVTNGLVNLYAKCGHLHQALLVFDEMP 32 FN L+Q+T K L KGRALHA ++K S ++ N L+N YAKC HL +A LVFD + Sbjct: 11 FNSLVQFTHQKSLQKGRALHAQIIKLASSSSCIYLANSLINFYAKCCHLPKAKLVFDRIH 70 Query: 31 YRDVVSWNCL 2 +DV+SWNCL Sbjct: 71 NKDVISWNCL 80 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/79 (35%), Positives = 44/79 (55%) Frame = -2 Query: 238 MSSTSLSRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQ 59 ++ S+ +AC NL +GR +HA +K GL + + L +YAKCG+L + Sbjct: 415 LTMASVLKACSNLAA-------FDQGRQIHARTIKYGLGLEVTIGSALSTMYAKCGNLEE 467 Query: 58 ALLVFDEMPYRDVVSWNCL 2 +VF MP RD++SWN + Sbjct: 468 GNIVFRRMPERDIISWNAM 486 >ref|XP_002284799.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680 [Vitis vinifera] gi|302141693|emb|CBI18896.3| unnamed protein product [Vitis vinifera] Length = 703 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/73 (49%), Positives = 51/73 (69%) Frame = -2 Query: 220 SRACFNLLLQYTEHKKLHKGRALHAHVLKTGLLSHTFVTNGLVNLYAKCGHLHQALLVFD 41 +R+ F LLQYT ++ L KG+ALHA ++K+ S ++ N LVNLYAKC L +A VF+ Sbjct: 6 NRSFFTALLQYTHNRSLQKGKALHAQIIKSSS-SCVYIANSLVNLYAKCQRLREAKFVFE 64 Query: 40 EMPYRDVVSWNCL 2 + +DVVSWNC+ Sbjct: 65 RIQNKDVVSWNCI 77