BLASTX nr result
ID: Cinnamomum24_contig00025253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025253 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010644371.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 emb|CAN69066.1| hypothetical protein VITISV_016070 [Vitis vinifera] 56 9e-06 >ref|XP_010644371.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31790 [Vitis vinifera] Length = 469 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 386 HGLCTEAIKLLYEMKAAGIEPQESMLYQARIACGS 282 HGL EAIK LY+MKAAGI+PQES+L + RIACGS Sbjct: 423 HGLYIEAIKFLYQMKAAGIQPQESLLNELRIACGS 457 >emb|CAN69066.1| hypothetical protein VITISV_016070 [Vitis vinifera] Length = 543 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 386 HGLCTEAIKLLYEMKAAGIEPQESMLYQARIACGS 282 HGL EAIK LY+MKAAGI+PQES+L + RIACGS Sbjct: 497 HGLYIEAIKFLYQMKAAGIQPQESLLNELRIACGS 531