BLASTX nr result
ID: Cinnamomum24_contig00025230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025230 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010942480.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-28 ref|XP_008797031.1| PREDICTED: pentatricopeptide repeat-containi... 127 3e-27 ref|XP_006857021.2| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_009412185.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 gb|ERN18488.1| hypothetical protein AMTR_s00197p00040880 [Ambore... 117 3e-24 ref|XP_009393109.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_008234953.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_007201156.1| hypothetical protein PRUPE_ppa004264mg [Prun... 114 3e-23 ref|XP_009792690.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_009609112.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 emb|CDP03577.1| unnamed protein product [Coffea canephora] 109 7e-22 ref|XP_012473970.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_010070321.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-21 ref|XP_010256475.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_007050731.1| Pentatricopeptide repeat-containing protein,... 107 5e-21 ref|XP_006360543.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_004243426.1| PREDICTED: pentatricopeptide repeat-containi... 106 6e-21 ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-20 ref|XP_008368899.1| PREDICTED: pentatricopeptide repeat-containi... 103 5e-20 ref|XP_006444185.1| hypothetical protein CICLE_v10019759mg [Citr... 102 9e-20 >ref|XP_010942480.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Elaeis guineensis] Length = 515 Score = 131 bits (330), Expect = 2e-28 Identities = 66/88 (75%), Positives = 73/88 (82%) Frame = -1 Query: 265 AGIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKS 86 A PMVSEEYAKAI LA R KNVDLAADLFSEAG GL S+YNALM+AYMYN LTKK+ Sbjct: 152 AEFPMVSEEYAKAIALAGRAKNVDLAADLFSEAGAVGLLETSLYNALMTAYMYNGLTKKA 211 Query: 85 LSLFEDLKRDPNCRPTIVTYNILLSLFG 2 +S+FEDLK D C PTIVTYNILLS++G Sbjct: 212 ISIFEDLKGDHRCTPTIVTYNILLSIYG 239 >ref|XP_008797031.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Phoenix dactylifera] Length = 360 Score = 127 bits (320), Expect = 3e-27 Identities = 62/84 (73%), Positives = 72/84 (85%) Frame = -1 Query: 253 MVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSLF 74 M+ EEYAKAI+LA R KN DLAADLFSEAG GL S+YNALM+AYMYN LTKK++S+F Sbjct: 1 MLPEEYAKAISLAGRAKNADLAADLFSEAGAVGLLETSLYNALMTAYMYNGLTKKAVSIF 60 Query: 73 EDLKRDPNCRPTIVTYNILLSLFG 2 EDLKRD C+PTIVTYNILLS++G Sbjct: 61 EDLKRDSRCKPTIVTYNILLSIYG 84 >ref|XP_006857021.2| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Amborella trichopoda] Length = 598 Score = 117 bits (293), Expect = 3e-24 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 1/89 (1%) Frame = -1 Query: 265 AGIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLC-SVSVYNALMSAYMYNDLTKK 89 +G+ M+ EEY+K I A R+KN+DLA +LFSEA G+ S S+YNALM+AYMYN L KK Sbjct: 234 SGVQMLYEEYSKGIMYAGRVKNIDLAVELFSEANTRGIKRSTSLYNALMTAYMYNGLIKK 293 Query: 88 SLSLFEDLKRDPNCRPTIVTYNILLSLFG 2 SL++FEDLKR+ +CRPT+VTYNILLS+FG Sbjct: 294 SLAVFEDLKREAHCRPTLVTYNILLSIFG 322 >ref|XP_009412185.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Musa acuminata subsp. malaccensis] Length = 360 Score = 117 bits (293), Expect = 3e-24 Identities = 59/84 (70%), Positives = 72/84 (85%) Frame = -1 Query: 253 MVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSLF 74 M+SEEY+KAITLA R KNV LA +LFS+A GL + +YNALMSAYMY+ LTKK++S+F Sbjct: 1 MLSEEYSKAITLAGRTKNVGLATELFSDAIDAGLRNACLYNALMSAYMYSGLTKKAVSVF 60 Query: 73 EDLKRDPNCRPTIVTYNILLSLFG 2 EDLK+D NC+PTIVTYNILLS+FG Sbjct: 61 EDLKQDFNCKPTIVTYNILLSVFG 84 >gb|ERN18488.1| hypothetical protein AMTR_s00197p00040880 [Amborella trichopoda] Length = 536 Score = 117 bits (293), Expect = 3e-24 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 1/89 (1%) Frame = -1 Query: 265 AGIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLC-SVSVYNALMSAYMYNDLTKK 89 +G+ M+ EEY+K I A R+KN+DLA +LFSEA G+ S S+YNALM+AYMYN L KK Sbjct: 172 SGVQMLYEEYSKGIMYAGRVKNIDLAVELFSEANTRGIKRSTSLYNALMTAYMYNGLIKK 231 Query: 88 SLSLFEDLKRDPNCRPTIVTYNILLSLFG 2 SL++FEDLKR+ +CRPT+VTYNILLS+FG Sbjct: 232 SLAVFEDLKREAHCRPTLVTYNILLSIFG 260 >ref|XP_009393109.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Musa acuminata subsp. malaccensis] Length = 509 Score = 115 bits (289), Expect = 1e-23 Identities = 59/88 (67%), Positives = 72/88 (81%) Frame = -1 Query: 265 AGIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKS 86 A IPM+ EEY KAITLASR KNVDLAA+LFS+A +G+ V +YNALMS YM N LTKK+ Sbjct: 146 AEIPMLPEEYYKAITLASRTKNVDLAAELFSQAIADGIREVCLYNALMSTYMNNGLTKKA 205 Query: 85 LSLFEDLKRDPNCRPTIVTYNILLSLFG 2 + +FE LK+D C+PTIV+YNILLS+FG Sbjct: 206 IWVFEVLKQDAECKPTIVSYNILLSVFG 233 >ref|XP_008234953.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Prunus mume] Length = 519 Score = 114 bits (286), Expect = 2e-23 Identities = 56/87 (64%), Positives = 68/87 (78%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM EEYAKAITLA + KNV+LA +LF+EA + + S+YNALMSAYM+N L K Sbjct: 157 GTPMTPEEYAKAITLAGKTKNVELAVELFTEAVNKRIKTTSIYNALMSAYMFNGLAAKCQ 216 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 SLF DLKR+P+C PTIVTYNIL+S+FG Sbjct: 217 SLFRDLKREPDCSPTIVTYNILISVFG 243 >ref|XP_007201156.1| hypothetical protein PRUPE_ppa004264mg [Prunus persica] gi|462396556|gb|EMJ02355.1| hypothetical protein PRUPE_ppa004264mg [Prunus persica] Length = 519 Score = 114 bits (285), Expect = 3e-23 Identities = 56/87 (64%), Positives = 68/87 (78%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM EEYAKAITLA + KNV+LA +LF+EA + + S+YNALMSAYM+N L K Sbjct: 157 GTPMTPEEYAKAITLAGKTKNVELAVELFTEALNKRIKTTSIYNALMSAYMFNGLAAKCQ 216 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 SLF DLKR+P+C PTIVTYNIL+S+FG Sbjct: 217 SLFRDLKREPDCSPTIVTYNILISVFG 243 >ref|XP_009792690.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492743|ref|XP_009792691.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492745|ref|XP_009792692.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492748|ref|XP_009792693.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492750|ref|XP_009792694.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492752|ref|XP_009792695.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492755|ref|XP_009792696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] gi|698492757|ref|XP_009792697.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Nicotiana sylvestris] Length = 572 Score = 110 bits (275), Expect = 4e-22 Identities = 54/85 (63%), Positives = 66/85 (77%) Frame = -1 Query: 256 PMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSL 77 PM +EEY+KAI +A R+KNVDLAA+LF EA L S S+YNALM+AYM+N L K S+ Sbjct: 215 PMTAEEYSKAIVVAGRLKNVDLAAELFKEASNKQLKSTSLYNALMTAYMFNGLAVKCQSV 274 Query: 76 FEDLKRDPNCRPTIVTYNILLSLFG 2 F DLKR+ C PTIVTYNIL+S+FG Sbjct: 275 FRDLKREATCTPTIVTYNILISVFG 299 >ref|XP_009609112.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Nicotiana tomentosiformis] Length = 509 Score = 110 bits (275), Expect = 4e-22 Identities = 54/85 (63%), Positives = 66/85 (77%) Frame = -1 Query: 256 PMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSL 77 PM +EEY+KAI +A R+KNVDLAA+LF EA L S S+YNALM+AYM+N L K S+ Sbjct: 152 PMTAEEYSKAIVVAGRLKNVDLAAELFKEASNKQLKSTSLYNALMTAYMFNGLAVKCQSV 211 Query: 76 FEDLKRDPNCRPTIVTYNILLSLFG 2 F DLKR+ C PTIVTYNIL+S+FG Sbjct: 212 FRDLKREATCTPTIVTYNILISVFG 236 >emb|CDP03577.1| unnamed protein product [Coffea canephora] Length = 522 Score = 109 bits (273), Expect = 7e-22 Identities = 54/87 (62%), Positives = 66/87 (75%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM +EEYA ITLA R+KNVDLAA+LF+EA L S+YNALMSAYMYN L K Sbjct: 160 GAPMTNEEYATGITLAGRLKNVDLAAELFAEAANKKLKETSLYNALMSAYMYNGLAAKCQ 219 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 +F DL+++ C+PTIVTYNIL+S+FG Sbjct: 220 LVFWDLRQEETCKPTIVTYNILISVFG 246 >ref|XP_012473970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 isoform X1 [Gossypium raimondii] gi|823148125|ref|XP_012473971.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 isoform X2 [Gossypium raimondii] gi|763755832|gb|KJB23163.1| hypothetical protein B456_004G084600 [Gossypium raimondii] Length = 532 Score = 108 bits (269), Expect = 2e-21 Identities = 53/87 (60%), Positives = 65/87 (74%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM SEEYA IT+A R+KNVDLA +LFSEA L + S YNALMSAYM+N L K Sbjct: 171 GYPMTSEEYASGITIAGRIKNVDLAVELFSEADSKQLKTTSTYNALMSAYMFNGLIDKCQ 230 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 +F +LK++P C P+IVTYNIL+S+FG Sbjct: 231 LVFRNLKKEPYCSPSIVTYNILISVFG 257 >ref|XP_010070321.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Eucalyptus grandis] gi|629092991|gb|KCW58986.1| hypothetical protein EUGRSUZ_H01610 [Eucalyptus grandis] Length = 514 Score = 108 bits (269), Expect = 2e-21 Identities = 53/87 (60%), Positives = 66/87 (75%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 GIPM SEEY K IT+A R+K+VDLA +LF+EA L + S YNALM AYMYN L K Sbjct: 152 GIPMTSEEYVKGITVAGRIKDVDLATELFTEATSKRLKANSTYNALMGAYMYNGLAGKCQ 211 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 LF++LK+D +C P+IVTYNIL+S+FG Sbjct: 212 KLFQELKKDADCSPSIVTYNILISVFG 238 >ref|XP_010256475.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Nelumbo nucifera] gi|720001815|ref|XP_010256476.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Nelumbo nucifera] gi|720001818|ref|XP_010256477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Nelumbo nucifera] Length = 538 Score = 107 bits (267), Expect = 4e-21 Identities = 49/87 (56%), Positives = 65/87 (74%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 GIPMV +EY K IT+A R NVDLA +LF++A G+ S YNALM AYMYN +K+ Sbjct: 170 GIPMVLKEYVKGITIAGRAMNVDLALELFNDAANRGIKSTCTYNALMGAYMYNGFAEKAQ 229 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 ++F DLKR+ NC P++VTYN+L+S+FG Sbjct: 230 AVFRDLKREQNCSPSVVTYNMLISIFG 256 >ref|XP_007050731.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508702992|gb|EOX94888.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 529 Score = 107 bits (266), Expect = 5e-21 Identities = 51/87 (58%), Positives = 64/87 (73%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM EEYA I +A R++NVDLA +LF+EA L S S YNALMSAYMY+ L +K Sbjct: 167 GYPMTEEEYASGIVIAGRIRNVDLAVELFAEAANKQLKSTSTYNALMSAYMYSGLAEKCQ 226 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 +F D KR+P+C P+IVTYNIL+S+FG Sbjct: 227 LVFRDFKREPDCSPSIVTYNILISVFG 253 >ref|XP_006360543.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Solanum tuberosum] Length = 504 Score = 106 bits (265), Expect = 6e-21 Identities = 54/85 (63%), Positives = 63/85 (74%) Frame = -1 Query: 256 PMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSL 77 PM EEY+KAI +A R+KNVDLAA LF EA L S S+YNALM+AYM N L K S+ Sbjct: 147 PMTVEEYSKAIVVAGRLKNVDLAAKLFKEASNKQLKSTSLYNALMTAYMINGLAVKCQSV 206 Query: 76 FEDLKRDPNCRPTIVTYNILLSLFG 2 F DLKR+ C PTIVTYNIL+S+FG Sbjct: 207 FRDLKREATCTPTIVTYNILISVFG 231 >ref|XP_004243426.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Solanum lycopersicum] gi|723715538|ref|XP_010323785.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Solanum lycopersicum] gi|723715541|ref|XP_010323786.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Solanum lycopersicum] Length = 504 Score = 106 bits (265), Expect = 6e-21 Identities = 53/85 (62%), Positives = 63/85 (74%) Frame = -1 Query: 256 PMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSL 77 PM EEY+KAI +A R+KN+DLAA LF EA L S S+YNALM+AYM N L K S+ Sbjct: 147 PMTVEEYSKAIVMAGRLKNIDLAAKLFKEASNKRLKSTSLYNALMTAYMINGLAVKCQSV 206 Query: 76 FEDLKRDPNCRPTIVTYNILLSLFG 2 F DLKR+ C PTIVTYNIL+S+FG Sbjct: 207 FRDLKREATCTPTIVTYNILISVFG 231 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|731395191|ref|XP_010652090.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 105 bits (261), Expect = 2e-20 Identities = 52/86 (60%), Positives = 64/86 (74%) Frame = -1 Query: 259 IPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLS 80 IPM SEEYAK I++A R KNVDLA +LF+EA + + S YNALM AYM N +K + Sbjct: 133 IPMTSEEYAKGISVAGRTKNVDLAVELFTEAANKQIKTTSTYNALMGAYMCNGHAEKCQA 192 Query: 79 LFEDLKRDPNCRPTIVTYNILLSLFG 2 LF DLKR+ +C PTIVTYNIL+S+FG Sbjct: 193 LFRDLKREASCSPTIVTYNILISVFG 218 >ref|XP_008368899.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Malus domestica] gi|657954894|ref|XP_008368900.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Malus domestica] Length = 527 Score = 103 bits (257), Expect = 5e-20 Identities = 51/84 (60%), Positives = 66/84 (78%) Frame = -1 Query: 253 MVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSLSLF 74 M +EEYAKAI +A + KNV+LA +LF+EA + + S+YNALMSAYM+N T K SLF Sbjct: 168 MSAEEYAKAIIIAGKAKNVELALELFTEAINKRIKTTSIYNALMSAYMFNGHTAKCQSLF 227 Query: 73 EDLKRDPNCRPTIVTYNILLSLFG 2 DLK++P+C PTIVTYNIL+S+FG Sbjct: 228 RDLKKEPDCCPTIVTYNILISVFG 251 >ref|XP_006444185.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|567903396|ref|XP_006444186.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|568852322|ref|XP_006479827.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like isoform X1 [Citrus sinensis] gi|557546447|gb|ESR57425.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|557546448|gb|ESR57426.1| hypothetical protein CICLE_v10019759mg [Citrus clementina] gi|641868767|gb|KDO87451.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] gi|641868768|gb|KDO87452.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] gi|641868769|gb|KDO87453.1| hypothetical protein CISIN_1g010292mg [Citrus sinensis] Length = 513 Score = 102 bits (255), Expect = 9e-20 Identities = 50/87 (57%), Positives = 61/87 (70%) Frame = -1 Query: 262 GIPMVSEEYAKAITLASRMKNVDLAADLFSEAGINGLCSVSVYNALMSAYMYNDLTKKSL 83 G PM EEY K I A R+ NVDLAADLF+EA L ++ YNAL+ AYMYN L+ K Sbjct: 151 GTPMTKEEYTKGIKFAGRINNVDLAADLFAEAANKHLKTIGTYNALLGAYMYNGLSDKCQ 210 Query: 82 SLFEDLKRDPNCRPTIVTYNILLSLFG 2 SLF DLK++ N P+IVTYN L+S+FG Sbjct: 211 SLFRDLKKEANISPSIVTYNTLISVFG 237