BLASTX nr result
ID: Cinnamomum24_contig00025091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00025091 (279 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843037.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [A... 66 1e-08 ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 is... 65 3e-08 ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-li... 64 3e-08 ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citr... 64 3e-08 ref|XP_012464670.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [G... 64 4e-08 gb|KJB83874.1| hypothetical protein B456_013G269100, partial [Go... 64 4e-08 emb|CDP07051.1| unnamed protein product [Coffea canephora] 64 4e-08 ref|XP_009786809.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [N... 64 6e-08 ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [N... 64 6e-08 ref|XP_007016849.1| AMP-dependent synthetase and ligase family p... 64 6e-08 ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-... 63 8e-08 ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [E... 63 8e-08 gb|KCW87479.1| hypothetical protein EUGRSUZ_B03943 [Eucalyptus g... 63 8e-08 gb|ALD83616.1| 4-coumarate-CoA ligase 7-2 [Morus alba] 63 1e-07 ref|XP_008226338.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [P... 63 1e-07 emb|CBI30139.3| unnamed protein product [Vitis vinifera] 63 1e-07 ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [F... 63 1e-07 ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prun... 63 1e-07 ref|XP_009356915.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [P... 62 1e-07 ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [N... 62 2e-07 >ref|XP_006843037.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda] gi|769813717|ref|XP_011622865.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda] gi|769813719|ref|XP_011622866.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Amborella trichopoda] gi|548845234|gb|ERN04712.1| hypothetical protein AMTR_s00076p00189570 [Amborella trichopoda] Length = 543 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTFVNSVPKSASGKILRRELIEKVR+KM Sbjct: 510 FKRLRRVTFVNSVPKSASGKILRRELIEKVRSKM 543 >ref|XP_010918637.1| PREDICTED: 4-coumarate--CoA ligase-like 1 isoform X1 [Elaeis guineensis] Length = 544 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTFVNSVPKSASGKILRRELIEKVR+K+ Sbjct: 511 FKRLRRVTFVNSVPKSASGKILRRELIEKVRSKL 544 >ref|XP_006488032.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Citrus sinensis] Length = 545 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELI KVRAKM Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRELIAKVRAKM 545 >ref|XP_006424490.1| hypothetical protein CICLE_v10028138mg [Citrus clementina] gi|557526424|gb|ESR37730.1| hypothetical protein CICLE_v10028138mg [Citrus clementina] Length = 545 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELI KVRAKM Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRELIAKVRAKM 545 >ref|XP_012464670.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Gossypium raimondii] Length = 545 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRR+LIEKVRAK+ Sbjct: 512 FKRLRRVTFINSVPKSASGKILRRQLIEKVRAKI 545 >gb|KJB83874.1| hypothetical protein B456_013G269100, partial [Gossypium raimondii] Length = 583 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRR+LIEKVRAK+ Sbjct: 550 FKRLRRVTFINSVPKSASGKILRRQLIEKVRAKI 583 >emb|CDP07051.1| unnamed protein product [Coffea canephora] Length = 221 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELIEKVR+K+ Sbjct: 188 FKRLRRVTFINSVPKSASGKILRRELIEKVRSKV 221 >ref|XP_009786809.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana sylvestris] Length = 538 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLR+VTFVNSVPKSASGKILRRELIEKVR+K+ Sbjct: 505 FKRLRKVTFVNSVPKSASGKILRRELIEKVRSKL 538 >ref|XP_009603383.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nicotiana tomentosiformis] Length = 538 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLR+VTFVNSVPKSASGKILRRELIEKVR+K+ Sbjct: 505 FKRLRKVTFVNSVPKSASGKILRRELIEKVRSKL 538 >ref|XP_007016849.1| AMP-dependent synthetase and ligase family protein isoform 1 [Theobroma cacao] gi|508787212|gb|EOY34468.1| AMP-dependent synthetase and ligase family protein isoform 1 [Theobroma cacao] Length = 545 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF++SVPKSASGKILRRELIEKVR+KM Sbjct: 512 FKRLRRVTFISSVPKSASGKILRRELIEKVRSKM 545 >ref|XP_011089239.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 7 [Sesamum indicum] Length = 549 Score = 63.2 bits (152), Expect = 8e-08 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELI+KVR+K+ Sbjct: 516 FKRLRRVTFINSVPKSASGKILRRELIDKVRSKL 549 >ref|XP_010045319.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Eucalyptus grandis] Length = 544 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTFVNSVPKSASGKILRRELI KVRAK+ Sbjct: 511 FKRLRRVTFVNSVPKSASGKILRRELIAKVRAKI 544 >gb|KCW87479.1| hypothetical protein EUGRSUZ_B03943 [Eucalyptus grandis] Length = 670 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTFVNSVPKSASGKILRRELI KVRAK+ Sbjct: 637 FKRLRRVTFVNSVPKSASGKILRRELIAKVRAKI 670 >gb|ALD83616.1| 4-coumarate-CoA ligase 7-2 [Morus alba] Length = 539 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLR+VTF+NSVPKSASGKILRRELIEKVR+K+ Sbjct: 506 FKRLRKVTFINSVPKSASGKILRRELIEKVRSKI 539 >ref|XP_008226338.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Prunus mume] Length = 532 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELI+KVR+K+ Sbjct: 499 FKRLRRVTFINSVPKSASGKILRRELIDKVRSKI 532 >emb|CBI30139.3| unnamed protein product [Vitis vinifera] Length = 649 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+N+VPKSASGKILRRELIEKVR+K+ Sbjct: 616 FKRLRRVTFINNVPKSASGKILRRELIEKVRSKI 649 >ref|XP_004291645.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Fragaria vesca subsp. vesca] Length = 543 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+N+VPKSASGKILRRELIEKVR+K+ Sbjct: 510 FKRLRRVTFINTVPKSASGKILRRELIEKVRSKI 543 >ref|XP_007208457.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica] gi|462404099|gb|EMJ09656.1| hypothetical protein PRUPE_ppa003893mg [Prunus persica] Length = 542 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF+NSVPKSASGKILRRELI+KVR+K+ Sbjct: 509 FKRLRRVTFINSVPKSASGKILRRELIDKVRSKI 542 >ref|XP_009356915.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Pyrus x bretschneideri] Length = 545 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRV+F+NSVPKSASGKILRRELIEKVR+K+ Sbjct: 512 FKRLRRVSFINSVPKSASGKILRRELIEKVRSKI 545 >ref|XP_010267197.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Nelumbo nucifera] Length = 543 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 278 FKRLRRVTFVNSVPKSASGKILRRELIEKVRAKM 177 FKRLRRVTF NSVPKSASGKILRRELI+KVR+K+ Sbjct: 510 FKRLRRVTFTNSVPKSASGKILRRELIQKVRSKL 543