BLASTX nr result
ID: Cinnamomum24_contig00024962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024962 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010271100.1| PREDICTED: methylecgonone reductase-like [Ne... 61 3e-07 ref|XP_006492304.1| PREDICTED: non-functional NADPH-dependent co... 59 2e-06 ref|XP_006448064.1| hypothetical protein CICLE_v10017512mg [Citr... 59 2e-06 ref|XP_010271247.1| PREDICTED: methylecgonone reductase-like [Ne... 58 2e-06 gb|KDO42647.1| hypothetical protein CISIN_1g020025mg [Citrus sin... 58 2e-06 ref|XP_010255181.1| PREDICTED: non-functional NADPH-dependent co... 57 4e-06 ref|XP_006492288.1| PREDICTED: non-functional NADPH-dependent co... 57 4e-06 ref|XP_010043909.1| PREDICTED: non-functional NADPH-dependent co... 57 5e-06 ref|XP_006448063.1| hypothetical protein CICLE_v10015868mg [Citr... 57 5e-06 ref|XP_010043908.1| PREDICTED: non-functional NADPH-dependent co... 57 7e-06 ref|XP_010043914.1| PREDICTED: non-functional NADPH-dependent co... 56 9e-06 ref|XP_010043913.1| PREDICTED: non-functional NADPH-dependent co... 56 9e-06 gb|KCW85941.1| hypothetical protein EUGRSUZ_B02647 [Eucalyptus g... 56 9e-06 emb|CBI22984.3| unnamed protein product [Vitis vinifera] 56 9e-06 >ref|XP_010271100.1| PREDICTED: methylecgonone reductase-like [Nelumbo nucifera] Length = 314 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EEL KI++IPQ RGFSGE FVSP+GP+KSIE++WD Sbjct: 280 EELDKISRIPQRRGFSGEMFVSPNGPYKSIEEIWD 314 >ref|XP_006492304.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Citrus sinensis] gi|641810543|gb|KDO36963.1| hypothetical protein CISIN_1g020679mg [Citrus sinensis] Length = 323 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EELQKI QIPQYRG E VS DGP+KS+EDLWD Sbjct: 286 EELQKIEQIPQYRGSRAEVHVSEDGPYKSLEDLWD 320 >ref|XP_006448064.1| hypothetical protein CICLE_v10017512mg [Citrus clementina] gi|557550675|gb|ESR61304.1| hypothetical protein CICLE_v10017512mg [Citrus clementina] Length = 325 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EELQKI QIPQYRG E VS DGP+KS+EDLWD Sbjct: 288 EELQKIEQIPQYRGSRAEVHVSEDGPYKSLEDLWD 322 >ref|XP_010271247.1| PREDICTED: methylecgonone reductase-like [Nelumbo nucifera] Length = 473 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EEL KI +IPQ RG SGE FVSP+GP+KSIE++WD Sbjct: 439 EELDKIRRIPQRRGVSGEMFVSPNGPYKSIEEIWD 473 >gb|KDO42647.1| hypothetical protein CISIN_1g020025mg [Citrus sinensis] Length = 332 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EELQKI QIPQYRG E VS DGP+KS+EDLWD Sbjct: 295 EELQKIEQIPQYRGSRSEEHVSEDGPYKSLEDLWD 329 >ref|XP_010255181.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Nelumbo nucifera] Length = 318 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 327 EEELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EEE +KI QIPQ RG SGE FVS +GPF S+ED WD Sbjct: 280 EEESEKIGQIPQRRGLSGEVFVSENGPFNSVEDFWD 315 >ref|XP_006492288.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Citrus sinensis] Length = 335 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EELQKI QIPQYRG E VS DGP+KS+EDLWD Sbjct: 298 EELQKIEQIPQYRGNRTEVHVSEDGPYKSLEDLWD 332 >ref|XP_010043909.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Eucalyptus grandis] gi|629121447|gb|KCW85937.1| hypothetical protein EUGRSUZ_B02642 [Eucalyptus grandis] Length = 322 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWDE 217 EEL KI+QIPQ +G++G FVSPDGP++S E+LWDE Sbjct: 285 EELNKISQIPQKKGYAGLQFVSPDGPYRSPEELWDE 320 >ref|XP_006448063.1| hypothetical protein CICLE_v10015868mg [Citrus clementina] gi|557550674|gb|ESR61303.1| hypothetical protein CICLE_v10015868mg [Citrus clementina] Length = 335 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 EELQKI QIPQYRG E VS DGP+KS+EDLWD Sbjct: 298 EELQKIEQIPQYRGNRTEVHVSGDGPYKSLEDLWD 332 >ref|XP_010043908.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like [Eucalyptus grandis] gi|629121441|gb|KCW85931.1| hypothetical protein EUGRSUZ_B02640 [Eucalyptus grandis] Length = 334 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWD 220 +EL KI+QIPQ +GF G FVSPDGP+KS E+LWD Sbjct: 297 DELNKISQIPQKKGFPGVEFVSPDGPYKSTEELWD 331 >ref|XP_010043914.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like isoform X2 [Eucalyptus grandis] Length = 330 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWDE 217 EEL KI QIPQ +GF G F+SPDGP+KS E+ WDE Sbjct: 293 EELDKIRQIPQKKGFPGLEFISPDGPYKSPEEFWDE 328 >ref|XP_010043913.1| PREDICTED: non-functional NADPH-dependent codeinone reductase 2-like isoform X1 [Eucalyptus grandis] Length = 327 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWDE 217 EEL KI QIPQ +GF G F+SPDGP+KS E+ WDE Sbjct: 290 EELDKIRQIPQKKGFPGLEFISPDGPYKSPEEFWDE 325 >gb|KCW85941.1| hypothetical protein EUGRSUZ_B02647 [Eucalyptus grandis] Length = 234 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 324 EELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWDE 217 EEL KI QIPQ +GF G F+SPDGP+KS E+ WDE Sbjct: 197 EELDKIRQIPQKKGFPGLEFISPDGPYKSPEEFWDE 232 >emb|CBI22984.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 327 EEELQKINQIPQYRGFSGEAFVSPDGPFKSIEDLWDE 217 ++EL KI IPQ RGFSG FV P+GP+KS+E+LWD+ Sbjct: 207 DDELTKIENIPQRRGFSGHWFVHPNGPYKSVEELWDD 243