BLASTX nr result
ID: Cinnamomum24_contig00024938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024938 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossyp... 74 3e-11 ref|XP_003626135.2| low temperature and salt responsive family p... 74 3e-11 gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] 74 4e-11 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer ... 74 4e-11 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 74 4e-11 ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Ambore... 74 5e-11 ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa a... 74 5e-11 ref|XP_003626132.1| low temperature and salt responsive family p... 74 5e-11 gb|AEJ20974.1| cold-inducible protein [Caragana jubata] 73 7e-11 ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp.... 73 7e-11 ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta v... 72 1e-10 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 72 1e-10 ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [M... 72 2e-10 ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobrom... 72 2e-10 ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [P... 72 2e-10 gb|ADV02768.1| putative low temperature and salt responsive prot... 72 2e-10 ref|XP_004302326.1| PREDICTED: hydrophobic protein RCI2A [Fragar... 72 2e-10 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 72 2e-10 ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus ... 71 3e-10 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 71 3e-10 >ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] gi|763815865|gb|KJB82717.1| hypothetical protein B456_013G210800 [Gossypium raimondii] gi|763815866|gb|KJB82718.1| hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATCVDI++AI+LPPLGVFLKFGCQVEFW+CL+LT Sbjct: 5 STATCVDILLAIILPPLGVFLKFGCQVEFWICLVLT 40 >ref|XP_003626135.2| low temperature and salt responsive family protein [Medicago truncatula] gi|124360712|gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula] gi|657380240|gb|AES82353.2| low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+DII+AI+LPPLGVFLKFGC VEFWLCL+LT Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLT 37 >gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATC+DI++AI+LPPLGVFLKFGCQVEFW+CL+LT Sbjct: 5 STATCIDILLAIILPPLGVFLKFGCQVEFWICLVLT 40 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDII+AI+LPPLGVFLKFGC VEFW+CLILT Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 73.9 bits (180), Expect = 4e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDII+AI+LPPLGVFLKFGC VEFW+CLILT Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Amborella trichopoda] Length = 56 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATCVDII+AI+LPPLGVFLKFGC+VEFW+CL+LT Sbjct: 4 STATCVDIILAIILPPLGVFLKFGCKVEFWICLVLT 39 >ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] gi|695058893|ref|XP_009417777.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] Length = 54 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+DI++AI+LPPLGVFLKFGC+VEFWLCL+LT Sbjct: 1 MGTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLT 37 >ref|XP_003626132.1| low temperature and salt responsive family protein [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| low temperature and salt responsive family protein [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+DII+AI+LPPLGVFLKFGC VEFW+CLILT Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >gb|AEJ20974.1| cold-inducible protein [Caragana jubata] Length = 54 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+DII+AI+LPPLGVFLKFGC VEFW+CL+LT Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLVLT 37 >ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330378|gb|EFH60797.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDIIIAILLPPLGVFL+FGC VEFW+CL+LT Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLT 37 >ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris] gi|870845968|gb|KMS98602.1| hypothetical protein BVRB_3g070450 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 72.4 bits (176), Expect = 1e-10 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATC+DI++AI+LPPLGVFLKFGC+VEFW+CL+LT Sbjct: 4 STATCIDILLAIILPPLGVFLKFGCKVEFWICLVLT 39 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDII+AI+LPPLGVFL+FGC+VEFW+CL+LT Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLT 37 >ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 54 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+D+++AI+LPPLGVFLKFGC+VEFWLCL+LT Sbjct: 1 MGTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLT 37 >ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobroma cacao] gi|508719879|gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] Length = 58 Score = 72.0 bits (175), Expect = 2e-10 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATCVDI++AI+LPPLGVFLK+GC+VEFW+CL+LT Sbjct: 5 STATCVDILLAIILPPLGVFLKYGCEVEFWICLVLT 40 >ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] gi|694379683|ref|XP_009366019.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDIIIAILLPPLGVFL+FGC EFW+CL+LT Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLT 37 >gb|ADV02768.1| putative low temperature and salt responsive protein isoform 1 [Ipomoea batatas] gi|317134413|gb|ADV02769.1| putative low temperature and salt responsive protein isoform 2 [Ipomoea batatas] Length = 57 Score = 71.6 bits (174), Expect = 2e-10 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 270 STATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 STATC+DI++AI+LPPLGVFLKFGCQVEFW+C +LT Sbjct: 5 STATCIDILLAIILPPLGVFLKFGCQVEFWICCLLT 40 >ref|XP_004302326.1| PREDICTED: hydrophobic protein RCI2A [Fragaria vesca subsp. vesca] Length = 54 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M ATCVDIIIAILLPPLGVFL+FGC VEFW+CLILT Sbjct: 1 MGAATCVDIIIAILLPPLGVFLRFGCGVEFWICLILT 37 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 71.6 bits (174), Expect = 2e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATCVDII+A++LPPLGVFLKFGC+ EFW+CL+LT Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLT 37 >ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica] gi|658020398|ref|XP_008345581.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 273 MSTATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 M TATC+DIIIAILLPPLGVFL+FGC EFW+CL+LT Sbjct: 1 MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLT 37 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|641837447|gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] gi|641837448|gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 71.2 bits (173), Expect = 3e-10 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = -3 Query: 267 TATCVDIIIAILLPPLGVFLKFGCQVEFWLCLILT 163 TATC+DII+AI+LPPLGVFLKFGC+VEFW+CL+LT Sbjct: 6 TATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40