BLASTX nr result
ID: Cinnamomum24_contig00024805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024805 (645 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013461787.1| P-loop nucleoside triphosphate hydrolase sup... 58 4e-06 >ref|XP_013461787.1| P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] gi|657395548|gb|KEH35822.1| P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] Length = 285 Score = 58.2 bits (139), Expect = 4e-06 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 163 YFDGMPLSCRDARIFTFSTNNNEQLDSSFLH---MDMCIHMSYLKASAFIILASN 318 Y DG+ SC + RI F+TN+ +++D + LH MDM IH+S+LKA AF ILASN Sbjct: 171 YMDGLWSSCGEERIIVFTTNHKDKVDPALLHPGQMDMHIHLSFLKAKAFRILASN 225