BLASTX nr result
ID: Cinnamomum24_contig00024788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00024788 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 54 8e-11 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 53.9 bits (128), Expect(2) = 8e-11 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 151 KKFQIFYYISIVISIWVFLLEPYEMKFSYTVLRGG 47 KKFQ FY IS+ + WVFL E YEMKFSYTVL GG Sbjct: 12 KKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGG 46 Score = 39.3 bits (90), Expect(2) = 8e-11 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -2 Query: 51 GESPWFTYLNKVYDWFE 1 G S WFTYLNKVYDWFE Sbjct: 45 GGSSWFTYLNKVYDWFE 61