BLASTX nr result
ID: Cinnamomum24_contig00023910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00023910 (287 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010906108.1| PREDICTED: single myb histone 6-like isoform... 61 3e-07 ref|XP_010906106.1| PREDICTED: single myb histone 5-like isoform... 61 3e-07 ref|XP_008777844.1| PREDICTED: single myb histone 6-like [Phoeni... 57 4e-06 >ref|XP_010906108.1| PREDICTED: single myb histone 6-like isoform X2 [Elaeis guineensis] Length = 298 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -2 Query: 286 FSEGRSSGLPLLEGKPRESFKVEKDDFRPLTKSQIDSDLAKMRSMT 149 FS G+SS L L +GK RE ++EKDD +PLTKSQ+D++LA+MR+MT Sbjct: 193 FSVGKSSNLSLRDGKHRECSRLEKDDIKPLTKSQVDAELARMRNMT 238 >ref|XP_010906106.1| PREDICTED: single myb histone 5-like isoform X1 [Elaeis guineensis] gi|743870685|ref|XP_010906107.1| PREDICTED: single myb histone 5-like isoform X1 [Elaeis guineensis] Length = 356 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -2 Query: 286 FSEGRSSGLPLLEGKPRESFKVEKDDFRPLTKSQIDSDLAKMRSMT 149 FS G+SS L L +GK RE ++EKDD +PLTKSQ+D++LA+MR+MT Sbjct: 193 FSVGKSSNLSLRDGKHRECSRLEKDDIKPLTKSQVDAELARMRNMT 238 >ref|XP_008777844.1| PREDICTED: single myb histone 6-like [Phoenix dactylifera] Length = 298 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = -2 Query: 286 FSEGRSSGLPLLEGKPRESFKVEKDDFRPLTKSQIDSDLAKMRSMT 149 FS G++S L L +GK RES +EKDD +PLTKSQ+D++LA+MR++T Sbjct: 193 FSLGKNSNLLLPDGKRRESSGLEKDDVKPLTKSQVDAELARMRNLT 238