BLASTX nr result
ID: Cinnamomum24_contig00023734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00023734 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516872.1| hypothetical protein GlmaxMp23 (mitochondrio... 57 2e-14 gb|AGC78901.1| hypothetical protein (mitochondrion) [Vicia faba]... 77 5e-12 ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macroc... 59 1e-06 >ref|YP_007516872.1| hypothetical protein GlmaxMp23 (mitochondrion) [Glycine max] gi|403311593|gb|AFR34341.1| hypothetical protein GlmaxMp23 (mitochondrion) [Glycine max] Length = 103 Score = 57.4 bits (137), Expect(3) = 2e-14 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 137 SCFHSLKILSTKEGQRGILQ*LSLTPSTRR 48 SCFHSLKILSTKEGQRGIL+ LSLTPSTRR Sbjct: 74 SCFHSLKILSTKEGQRGILKLLSLTPSTRR 103 Score = 47.0 bits (110), Expect(3) = 2e-14 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 220 RKEGGPSSSHHINGARLCMRLVLRSK 143 RKEGGPSS HHI GA+LCMRLVLRSK Sbjct: 25 RKEGGPSS-HHIKGAQLCMRLVLRSK 49 Score = 20.8 bits (42), Expect(3) = 2e-14 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 252 NGVVNKDWCGKE 217 N VVNKD C KE Sbjct: 16 NIVVNKDGCRKE 27 >gb|AGC78901.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803279|gb|AGC79014.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 142 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 135 LFPLIEDSIYKRRSTGDTTVALTDTIYEKVRSSFFPAAVRF 13 +F LIEDSIYKRRSTGDT VALTDTIYEKVRSSFFPAA+RF Sbjct: 1 MFTLIEDSIYKRRSTGDTKVALTDTIYEKVRSSFFPAAIRF 41 >ref|YP_004842085.1| hypothetical protein BemaM_p038 [Beta macrocarpa] gi|345500071|emb|CBX24887.1| hypothetical protein [Beta macrocarpa] Length = 160 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 135 LFPLIEDSIYKRRSTGDTTVALTDTIYEKVRSSFF 31 LFPLIEDSIYKRRST DT +ALTDTIYEKVR F Sbjct: 35 LFPLIEDSIYKRRSTEDTQIALTDTIYEKVRQCNF 69