BLASTX nr result
ID: Cinnamomum24_contig00020549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00020549 (391 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009387100.1| PREDICTED: mitochondrial ubiquitin ligase ac... 84 4e-14 gb|ABK24069.1| unknown [Picea sitchensis] 84 4e-14 ref|XP_008462310.1| PREDICTED: mitochondrial ubiquitin ligase ac... 84 5e-14 ref|XP_008462309.1| PREDICTED: mitochondrial ubiquitin ligase ac... 84 5e-14 ref|XP_011659624.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 2e-13 ref|XP_011659623.1| PREDICTED: uncharacterized protein LOC101203... 82 2e-13 ref|XP_011659622.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 2e-13 emb|CDO97851.1| unnamed protein product [Coffea canephora] 80 6e-13 ref|XP_011072584.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 1e-12 ref|XP_010685312.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 1e-12 gb|KNA26119.1| hypothetical protein SOVF_000360 [Spinacia oleracea] 79 2e-12 ref|XP_009781223.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_009594761.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_010064037.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_006361337.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_004252396.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-12 ref|XP_010086805.1| Mitochondrial ubiquitin ligase activator of ... 78 2e-12 ref|XP_008228194.1| PREDICTED: mitochondrial ubiquitin ligase ac... 78 2e-12 ref|XP_012856587.1| PREDICTED: mitochondrial ubiquitin ligase ac... 78 2e-12 ref|XP_007215503.1| hypothetical protein PRUPE_ppa006914mg [Prun... 78 2e-12 >ref|XP_009387100.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Musa acuminata subsp. malaccensis] gi|695079366|ref|XP_009387101.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Musa acuminata subsp. malaccensis] Length = 384 Score = 84.0 bits (206), Expect = 4e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCAL VERDS+PKCPVCRQ +R+S+RIYDS Sbjct: 343 AFIPCGHLVCCSRCALHVERDSSPKCPVCRQDVRSSIRIYDS 384 >gb|ABK24069.1| unknown [Picea sitchensis] Length = 394 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGH VCC RCA LVERDSNPKCPVCRQ++R SVRIYDS Sbjct: 353 AFIPCGHHVCCSRCAQLVERDSNPKCPVCRQNVRNSVRIYDS 394 >ref|XP_008462310.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X2 [Cucumis melo] Length = 331 Score = 83.6 bits (205), Expect = 5e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCA+ VERDS+PKCP+CRQ IR+SVRIYDS Sbjct: 290 AFIPCGHLVCCERCAVSVERDSSPKCPICRQQIRSSVRIYDS 331 >ref|XP_008462309.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X1 [Cucumis melo] Length = 405 Score = 83.6 bits (205), Expect = 5e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCA+ VERDS+PKCP+CRQ IR+SVRIYDS Sbjct: 364 AFIPCGHLVCCERCAVSVERDSSPKCPICRQQIRSSVRIYDS 405 >ref|XP_011659624.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X3 [Cucumis sativus] Length = 324 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCA+ VER+S+PKCP+CRQ IR+SVRIYDS Sbjct: 283 AFIPCGHLVCCERCAVSVERESSPKCPICRQQIRSSVRIYDS 324 >ref|XP_011659623.1| PREDICTED: uncharacterized protein LOC101203729 isoform X2 [Cucumis sativus] Length = 365 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCA+ VER+S+PKCP+CRQ IR+SVRIYDS Sbjct: 324 AFIPCGHLVCCERCAVSVERESSPKCPICRQQIRSSVRIYDS 365 >ref|XP_011659622.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X1 [Cucumis sativus] gi|700190257|gb|KGN45490.1| hypothetical protein Csa_7G450490 [Cucumis sativus] Length = 405 Score = 82.0 bits (201), Expect = 2e-13 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCA+ VER+S+PKCP+CRQ IR+SVRIYDS Sbjct: 364 AFIPCGHLVCCERCAVSVERESSPKCPICRQQIRSSVRIYDS 405 >emb|CDO97851.1| unnamed protein product [Coffea canephora] Length = 396 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC CAL VERD +PKCPVCRQ+IR SVRIYDS Sbjct: 355 AFVPCGHLVCCQSCALSVERDLSPKCPVCRQTIRNSVRIYDS 396 >ref|XP_011072584.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Sesamum indicum] Length = 398 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC RCAL VER+ PKCPVCRQ IR+SVRIYDS Sbjct: 357 AFIPCGHLVCCQRCALSVEREVLPKCPVCRQPIRSSVRIYDS 398 >ref|XP_010685312.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Beta vulgaris subsp. vulgaris] gi|870852950|gb|KMT04831.1| hypothetical protein BVRB_7g170020 [Beta vulgaris subsp. vulgaris] Length = 396 Score = 79.3 bits (194), Expect = 1e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGH+VCC RCA VERD +PKCPVCRQ+IR SVRIYDS Sbjct: 355 AFVPCGHMVCCQRCAFSVERDLSPKCPVCRQAIRGSVRIYDS 396 >gb|KNA26119.1| hypothetical protein SOVF_000360 [Spinacia oleracea] Length = 397 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCA VERD PKCPVCRQSIR SVRIYD+ Sbjct: 356 AFVPCGHLVCCRRCAFSVERDLAPKCPVCRQSIRGSVRIYDA 397 >ref|XP_009781223.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nicotiana sylvestris] Length = 391 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCAL VERD PKCPVCRQ+IR SV IYDS Sbjct: 350 AFVPCGHLVCCQRCALSVERDLAPKCPVCRQTIRCSVMIYDS 391 >ref|XP_009594761.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nicotiana tomentosiformis] Length = 392 Score = 78.6 bits (192), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCAL VERD PKCPVCRQSI +SV IYDS Sbjct: 351 AFVPCGHLVCCQRCALSVERDLAPKCPVCRQSIHSSVMIYDS 392 >ref|XP_010064037.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Eucalyptus grandis] gi|629105866|gb|KCW71335.1| hypothetical protein EUGRSUZ_F04419 [Eucalyptus grandis] Length = 395 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCAL VER+ +PKCPVCRQ+I SVRIYDS Sbjct: 354 AFVPCGHLVCCQRCALSVEREVSPKCPVCRQTITNSVRIYDS 395 >ref|XP_006361337.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Solanum tuberosum] Length = 393 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCAL VERD PKCP+CRQ+I +SVRIYDS Sbjct: 352 AFVPCGHLVCCQRCALSVERDLAPKCPLCRQTIHSSVRIYDS 393 >ref|XP_004252396.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Solanum lycopersicum] Length = 391 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCAL VERD PKCP+CRQ+I +SVRIYDS Sbjct: 350 AFVPCGHLVCCQRCALSVERDLAPKCPLCRQTIHSSVRIYDS 391 >ref|XP_010086805.1| Mitochondrial ubiquitin ligase activator of nfkb 1 [Morus notabilis] gi|587832984|gb|EXB23815.1| Mitochondrial ubiquitin ligase activator of nfkb 1 [Morus notabilis] Length = 393 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC CA+ VER+ PKCPVCRQ IRTSVRIYDS Sbjct: 352 AFIPCGHLVCCHICAISVEREVTPKCPVCRQEIRTSVRIYDS 393 >ref|XP_008228194.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Prunus mume] Length = 390 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC C++ +ERD PKCPVCRQ IRTSVRIYDS Sbjct: 349 AFIPCGHLVCCQLCSISIERDVAPKCPVCRQQIRTSVRIYDS 390 >ref|XP_012856587.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Erythranthe guttatus] gi|604301739|gb|EYU21325.1| hypothetical protein MIMGU_mgv1a007519mg [Erythranthe guttata] Length = 404 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AF+PCGHLVCC RCA VER+ +PKCPVCRQ IR SVRIYDS Sbjct: 363 AFVPCGHLVCCHRCAFSVEREVSPKCPVCRQPIRNSVRIYDS 404 >ref|XP_007215503.1| hypothetical protein PRUPE_ppa006914mg [Prunus persica] gi|462411653|gb|EMJ16702.1| hypothetical protein PRUPE_ppa006914mg [Prunus persica] Length = 390 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 391 AFIPCGHLVCCPRCALLVERDSNPKCPVCRQSIRTSVRIYDS 266 AFIPCGHLVCC C++ +ERD PKCPVCRQ IRTSVRIYDS Sbjct: 349 AFIPCGHLVCCQLCSISIERDVAPKCPVCRQQIRTSVRIYDS 390