BLASTX nr result
ID: Cinnamomum24_contig00020270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00020270 (603 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium r... 92 2e-16 ref|XP_002535798.1| conserved hypothetical protein [Ricinus comm... 72 2e-10 ref|XP_010106372.1| hypothetical protein L484_004400 [Morus nota... 60 9e-07 ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabac... 59 2e-06 >gb|KJB09782.1| hypothetical protein B456_001G165500 [Gossypium raimondii] Length = 732 Score = 92.4 bits (228), Expect = 2e-16 Identities = 59/111 (53%), Positives = 63/111 (56%), Gaps = 5/111 (4%) Frame = -3 Query: 574 TNRIDSTDMMDGMGRRFRL*--CYSFFRTLSPFRYLPPPRQ---KGRVDYLWELSRRSRW 410 TNRIDSTDM+DGMG CY RTLSPFRYLP P KGRVDYLW Sbjct: 361 TNRIDSTDMIDGMGSLCYDVDVCYDLVRTLSPFRYLPLPLYRLGKGRVDYLW-------- 412 Query: 409 SCEWLINCDCSLI*GCEAYLLNRQSKAKKTVDTSTIWVEGDDPNESTMKVA 257 G ++ +L KKTVDTST WVEGDDPNESTMKVA Sbjct: 413 --------------GAKSKIL----VTKKTVDTSTSWVEGDDPNESTMKVA 445 Score = 66.6 bits (161), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 93 YPHRKLTLFHTLPVDATAAITLAAGGEWLSD 1 YPHRKLTLFHTLPVDATAAITLAAGGEWLS+ Sbjct: 458 YPHRKLTLFHTLPVDATAAITLAAGGEWLSE 488 >ref|XP_002535798.1| conserved hypothetical protein [Ricinus communis] gi|223521924|gb|EEF26587.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 72.4 bits (176), Expect = 2e-10 Identities = 37/45 (82%), Positives = 37/45 (82%), Gaps = 4/45 (8%) Frame = +1 Query: 367 PKSNCNRSLSTTHKTTEIFDLAPTG-NPPGPS---DEGAEDNERE 489 PK NCNRSLSTTHKTTEIFDLAP G NPPGPS GAEDNERE Sbjct: 4 PKENCNRSLSTTHKTTEIFDLAPKGNNPPGPSPTYTRGAEDNERE 48 >ref|XP_010106372.1| hypothetical protein L484_004400 [Morus notabilis] gi|587922842|gb|EXC10222.1| hypothetical protein L484_004400 [Morus notabilis] Length = 133 Score = 60.1 bits (144), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 93 YPHRKLTLFHTLPVDATAAITLAAGGEWLSD 1 YPHRKLT+FH LPVDA AITLAAGGEWLS+ Sbjct: 63 YPHRKLTIFHALPVDARTAITLAAGGEWLSE 93 >ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabacum] gi|56806545|dbj|BAD83446.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 129 Score = 58.9 bits (141), Expect(2) = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 92 IHIESLPSSTHYRWMLQPLSLWLQEGN 12 IHIE LPSSTHYRWMLQPLSLWLQ+GN Sbjct: 9 IHIEILPSSTHYRWMLQPLSLWLQDGN 35 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 118 MQKVLIRPL 92 MQKVLIRP+ Sbjct: 1 MQKVLIRPI 9