BLASTX nr result
ID: Cinnamomum24_contig00020076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00020076 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249261.1| PREDICTED: WASH complex subunit strumpellin ... 58 3e-06 >ref|XP_010249261.1| PREDICTED: WASH complex subunit strumpellin homolog [Nelumbo nucifera] Length = 1153 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 104 DLLNFCSRAQTLISQLLLLSNRIPPEFRDRRYDP 3 +LLNF SRAQ+LIS++LLLS RIP EFRDRRYDP Sbjct: 22 ELLNFASRAQSLISEVLLLSGRIPNEFRDRRYDP 55