BLASTX nr result
ID: Cinnamomum24_contig00017324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00017324 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010650766.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] 82 2e-13 ref|XP_011099967.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_008218683.1| PREDICTED: pentatricopeptide repeat-containi... 77 6e-12 ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prun... 77 6e-12 ref|XP_002532388.1| pentatricopeptide repeat-containing protein,... 76 8e-12 ref|XP_012081691.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_012845104.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 gb|EYU30924.1| hypothetical protein MIMGU_mgv1a001068mg [Erythra... 72 1e-10 ref|XP_010023427.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_008361681.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_009341366.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_009796136.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_007047758.1| Pentatricopeptide repeat (PPR) superfamily p... 69 9e-10 ref|XP_006339168.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009595961.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_009613976.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_011018741.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_009777862.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_004249774.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 >ref|XP_010650766.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391457|ref|XP_010650767.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391459|ref|XP_010650768.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391461|ref|XP_010650769.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|731391463|ref|XP_010650770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] Length = 913 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/69 (59%), Positives = 48/69 (69%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +DS+ N +S+D VWK L+ E ALKL EKM+E GC DVS Y ALIAG C+ RLEEA Sbjct: 721 IDSVSNVNSVDIADVWKTLEYEIALKLFEKMVEHGCTIDVSIYGALIAGFCQQERLEEAQ 780 Query: 29 LLVRHMGER 3 LV HM ER Sbjct: 781 GLVHHMKER 789 >emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] Length = 1099 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/69 (59%), Positives = 48/69 (69%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +DS+ N +S+D VWK L+ E ALKL EKM+E GC DVS Y ALIAG C+ RLEEA Sbjct: 709 IDSVSNVNSVDIADVWKTLEYEIALKLFEKMVEHGCTIDVSIYGALIAGFCQQERLEEAQ 768 Query: 29 LLVRHMGER 3 LV HM ER Sbjct: 769 GLVHHMKER 777 >ref|XP_011099967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Sesamum indicum] gi|747103550|ref|XP_011099969.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Sesamum indicum] Length = 937 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/71 (53%), Positives = 51/71 (71%) Frame = -3 Query: 224 IWQTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGR 45 I +T D+ N SI+ VWK+++ +TALKL EKM E GC P+++TY+ALI GLCR GR Sbjct: 736 IGRTGFDAFPNDGSINIADVWKIMEHDTALKLFEKMKEHGCAPNINTYNALITGLCREGR 795 Query: 44 LEEAHLLVRHM 12 L+EA LV H+ Sbjct: 796 LQEAWRLVDHL 806 >ref|XP_008218683.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Prunus mume] Length = 751 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/69 (53%), Positives = 45/69 (65%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +D + N SSID GVWK + E AL+L EKM+ GC P +TYD LI GLC+ GRL+ A Sbjct: 559 LDLVPNVSSIDITGVWKTMDFEIALELFEKMVGHGCAPSTNTYDKLIVGLCKEGRLDVAQ 618 Query: 29 LLVRHMGER 3 L HM ER Sbjct: 619 SLYSHMRER 627 >ref|XP_007226363.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] gi|462423299|gb|EMJ27562.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] Length = 845 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/69 (53%), Positives = 45/69 (65%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +D + N SSID GVWK + E AL+L EKM+ GC P +TYD LI GLC+ GRL+ A Sbjct: 653 LDLVPNVSSIDITGVWKTMDFEIALELFEKMVGHGCAPSTNTYDKLIVGLCKEGRLDVAQ 712 Query: 29 LLVRHMGER 3 L HM ER Sbjct: 713 RLYSHMRER 721 >ref|XP_002532388.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527912|gb|EEF30000.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 676 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/68 (54%), Positives = 46/68 (67%) Frame = -3 Query: 206 DSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAHL 27 DS+ N D VWK++K ETAL+L EKM+E GC P+++TY LI GLC+VGRL A Sbjct: 485 DSIPNVFFADVADVWKMMKFETALELFEKMLEHGCSPNINTYAKLIIGLCKVGRLGVAQK 544 Query: 26 LVRHMGER 3 L HM ER Sbjct: 545 LFDHMNER 552 >ref|XP_012081691.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Jatropha curcas] gi|802674127|ref|XP_012081692.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Jatropha curcas] gi|643718596|gb|KDP29790.1| hypothetical protein JCGZ_18725 [Jatropha curcas] Length = 907 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/69 (50%), Positives = 48/69 (69%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +DS+ N S +D VWK ++ ETAL+L +KM E GC P+++TY LI GLC+V R+E A Sbjct: 715 LDSVPNVSFVDVADVWKTMEFETALQLFDKMREHGCTPNLNTYTKLIVGLCKVERMEVAQ 774 Query: 29 LLVRHMGER 3 L+ HM ER Sbjct: 775 RLLDHMNER 783 >ref|XP_012845104.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Erythranthe guttatus] Length = 927 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = -3 Query: 194 NTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAHLLVRH 15 N SI+ VWK ++ +TALKL EKM E GC P+V TY+ALI GLCR GR+EE LV H Sbjct: 736 NGGSINIADVWKTMEHDTALKLFEKMKECGCAPNVGTYNALITGLCREGRIEEGWKLVDH 795 Query: 14 M 12 + Sbjct: 796 L 796 >gb|EYU30924.1| hypothetical protein MIMGU_mgv1a001068mg [Erythranthe guttata] Length = 897 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = -3 Query: 194 NTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAHLLVRH 15 N SI+ VWK ++ +TALKL EKM E GC P+V TY+ALI GLCR GR+EE LV H Sbjct: 706 NGGSINIADVWKTMEHDTALKLFEKMKECGCAPNVGTYNALITGLCREGRIEEGWKLVDH 765 Query: 14 M 12 + Sbjct: 766 L 766 >ref|XP_010023427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Eucalyptus grandis] gi|702439849|ref|XP_010023428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Eucalyptus grandis] gi|629093686|gb|KCW59681.1| hypothetical protein EUGRSUZ_H02438 [Eucalyptus grandis] gi|629093687|gb|KCW59682.1| hypothetical protein EUGRSUZ_H02438 [Eucalyptus grandis] Length = 925 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -3 Query: 206 DSL-GNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 DSL N S +D+ VW+++ T LK +KM+E GC P+V+TY +I GLC+VGRLE A Sbjct: 733 DSLTSNISPVDKADVWRIVDFGTVLKFFDKMLEHGCAPNVNTYAKIIIGLCKVGRLEIAV 792 Query: 29 LLVRHMGER 3 +V+HM +R Sbjct: 793 RIVKHMRDR 801 >ref|XP_008361681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] gi|658051905|ref|XP_008361682.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Malus domestica] Length = 905 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/69 (50%), Positives = 42/69 (60%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +D + N S ID VWK++ + AL L EKM GC P +TYD LI GLC+ RLEEA Sbjct: 713 MDLISNVSLIDIADVWKIMDFDIALDLFEKMTGHGCAPSTNTYDKLIVGLCKERRLEEAQ 772 Query: 29 LLVRHMGER 3 L HM ER Sbjct: 773 RLYSHMKER 781 >ref|XP_009341366.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Pyrus x bretschneideri] Length = 905 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/68 (51%), Positives = 41/68 (60%) Frame = -3 Query: 206 DSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAHL 27 D + N S ID VWK+L + AL L EKM GC P +T+D LI GLC+ RLEEA Sbjct: 714 DLISNVSLIDIADVWKILDFDIALDLFEKMTGHGCAPSTNTFDKLIVGLCKERRLEEAQK 773 Query: 26 LVRHMGER 3 L HM ER Sbjct: 774 LYSHMKER 781 >ref|XP_009796136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] gi|698500806|ref|XP_009796137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] Length = 897 Score = 69.3 bits (168), Expect = 9e-10 Identities = 35/69 (50%), Positives = 46/69 (66%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET L+L +KM E GC P+ +T+++L GLCR GRLE Sbjct: 699 QGGLDIKTKASSINIADVWKVVKYETLLELFDKMGEYGCPPNTNTFNSLATGLCREGRLE 758 Query: 38 EAHLLVRHM 12 EA L+ HM Sbjct: 759 EASRLLDHM 767 >ref|XP_007047758.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590706571|ref|XP_007047759.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700019|gb|EOX91915.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700020|gb|EOX91916.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 946 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/64 (46%), Positives = 44/64 (68%) Frame = -3 Query: 194 NTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAHLLVRH 15 N + ++ VWK ++ +TAL+L EKM + GC+P+++TY LI GLC+VGR E A L H Sbjct: 759 NATLVNHADVWKTMEFDTALELFEKMHQHGCVPNINTYSKLIIGLCKVGRFEVAQRLFDH 818 Query: 14 MGER 3 M E+ Sbjct: 819 MREQ 822 >ref|XP_006339168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Solanum tuberosum] gi|565344128|ref|XP_006339169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Solanum tuberosum] gi|565344130|ref|XP_006339170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Solanum tuberosum] gi|565344132|ref|XP_006339171.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X4 [Solanum tuberosum] Length = 915 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET LKL +KM E GC P+ + + +L+ GLCR GRLE Sbjct: 717 QGGLDLKIEASSINIADVWKVVKYETLLKLFDKMEEHGCPPNTNVFSSLVIGLCREGRLE 776 Query: 38 EAHLLVRHM 12 EA L+ HM Sbjct: 777 EASRLLDHM 785 >ref|XP_009595961.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] gi|697174046|ref|XP_009595962.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] gi|697174048|ref|XP_009595963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] gi|697174050|ref|XP_009595964.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] gi|697174052|ref|XP_009595965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] gi|697174054|ref|XP_009595966.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] Length = 897 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET L+L +KM E GC P+ +T++++ GLCR GRLE Sbjct: 699 QGGLDIKTEASSINIADVWKVVKYETLLELFDKMGEYGCPPNTNTFNSVATGLCREGRLE 758 Query: 38 EAHLLVRHM 12 EA L+ HM Sbjct: 759 EASRLLDHM 767 >ref|XP_009613976.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana tomentosiformis] Length = 949 Score = 67.4 bits (163), Expect = 4e-09 Identities = 36/72 (50%), Positives = 45/72 (62%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET LKL +KM E C P+ +T+ +L GLCR GRLE Sbjct: 751 QGGLDLKTEASSINIADVWKVVKYETLLKLFDKMGEHECPPNTNTFSSLAIGLCREGRLE 810 Query: 38 EAHLLVRHMGER 3 EA L+ HM R Sbjct: 811 EASRLLDHMQSR 822 >ref|XP_011018741.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 isoform X1 [Populus euphratica] gi|743810430|ref|XP_011018742.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 isoform X1 [Populus euphratica] Length = 925 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/69 (46%), Positives = 46/69 (66%) Frame = -3 Query: 209 VDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLEEAH 30 +D + + + + VWK+++ ETAL+L EKM+E GC P V+TY LI G+C+VGR A+ Sbjct: 730 LDLVQSVTFFNAADVWKIMQFETALELFEKMMEHGCTPGVNTYAKLIIGVCKVGRWGVAN 789 Query: 29 LLVRHMGER 3 L HM ER Sbjct: 790 SLFNHMIER 798 >ref|XP_009777862.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] gi|698582572|ref|XP_009777863.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Nicotiana sylvestris] Length = 949 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/69 (52%), Positives = 43/69 (62%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET LKL EKM E GC P +T+ +L GLCR RLE Sbjct: 751 QGGLDLKTEASSINIADVWKVVKYETLLKLFEKMGEHGCPPSTNTFSSLAIGLCRERRLE 810 Query: 38 EAHLLVRHM 12 EA L+ HM Sbjct: 811 EASRLLDHM 819 >ref|XP_004249774.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Solanum lycopersicum] Length = 913 Score = 67.0 bits (162), Expect = 5e-09 Identities = 36/69 (52%), Positives = 44/69 (63%) Frame = -3 Query: 218 QTDVDSLGNTSSIDEMGVWKVLKIETALKLLEKMIEIGCIPDVSTYDALIAGLCRVGRLE 39 Q +D SSI+ VWKV+K ET LKLL KM E GC P+ + + +L GLCR GRLE Sbjct: 715 QGGLDLKIEASSINIADVWKVVKYETLLKLLNKMEEHGCPPNTNGFSSLAIGLCREGRLE 774 Query: 38 EAHLLVRHM 12 EA L+ HM Sbjct: 775 EASRLLDHM 783