BLASTX nr result
ID: Cinnamomum24_contig00017237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00017237 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272360.1| PREDICTED: pentatricopeptide repeat-containi... 162 1e-37 ref|XP_010272359.1| PREDICTED: pentatricopeptide repeat-containi... 162 1e-37 ref|XP_011628845.1| PREDICTED: pentatricopeptide repeat-containi... 160 2e-37 ref|XP_012092410.1| PREDICTED: pentatricopeptide repeat-containi... 159 7e-37 gb|KDP21001.1| hypothetical protein JCGZ_21472 [Jatropha curcas] 159 7e-37 ref|XP_002273710.2| PREDICTED: pentatricopeptide repeat-containi... 159 7e-37 emb|CAN74095.1| hypothetical protein VITISV_023708 [Vitis vinifera] 159 7e-37 ref|XP_012481451.1| PREDICTED: pentatricopeptide repeat-containi... 157 2e-36 ref|XP_007025555.1| Tetratricopeptide repeat-like superfamily pr... 157 2e-36 gb|KHN07701.1| Pentatricopeptide repeat-containing protein, chlo... 155 8e-36 ref|XP_003545972.2| PREDICTED: pentatricopeptide repeat-containi... 155 8e-36 ref|XP_007153023.1| hypothetical protein PHAVU_003G001300g [Phas... 155 1e-35 ref|XP_008787073.1| PREDICTED: putative pentatricopeptide repeat... 154 2e-35 ref|XP_007214178.1| hypothetical protein PRUPE_ppa019185mg [Prun... 154 2e-35 ref|XP_011027784.1| PREDICTED: pentatricopeptide repeat-containi... 154 2e-35 ref|XP_010932118.1| PREDICTED: putative pentatricopeptide repeat... 154 2e-35 ref|XP_011651139.1| PREDICTED: pentatricopeptide repeat-containi... 154 3e-35 ref|XP_008225136.1| PREDICTED: pentatricopeptide repeat-containi... 153 4e-35 ref|XP_009797200.1| PREDICTED: putative pentatricopeptide repeat... 152 7e-35 ref|XP_009600826.1| PREDICTED: putative pentatricopeptide repeat... 152 7e-35 >ref|XP_010272360.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X2 [Nelumbo nucifera] Length = 858 Score = 162 bits (409), Expect = 1e-37 Identities = 73/82 (89%), Positives = 79/82 (96%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DV+R+EKE+LL+HHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFICKIVSREI Sbjct: 777 DVDRSEKERLLFHHSEKLAVAFGLIATPEGAPIRVKKNLRVCVDCHTAFKFICKIVSREI 836 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHFRDG CSCGDYW Sbjct: 837 IVRDINRFHHFRDGSCSCGDYW 858 >ref|XP_010272359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X1 [Nelumbo nucifera] Length = 942 Score = 162 bits (409), Expect = 1e-37 Identities = 73/82 (89%), Positives = 79/82 (96%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DV+R+EKE+LL+HHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFICKIVSREI Sbjct: 861 DVDRSEKERLLFHHSEKLAVAFGLIATPEGAPIRVKKNLRVCVDCHTAFKFICKIVSREI 920 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHFRDG CSCGDYW Sbjct: 921 IVRDINRFHHFRDGSCSCGDYW 942 >ref|XP_011628845.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Amborella trichopoda] Length = 927 Score = 160 bits (406), Expect = 2e-37 Identities = 72/82 (87%), Positives = 78/82 (95%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE+ EKE+LLYHHSEK+AVAFGLISTP GAPIRVKKNLRVCGDCHTAFK+ICKIVSREI Sbjct: 846 DVEQGEKERLLYHHSEKLAVAFGLISTPEGAPIRVKKNLRVCGDCHTAFKYICKIVSREI 905 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINRFHHF+DG CSC DYW Sbjct: 906 IMRDINRFHHFKDGSCSCRDYW 927 >ref|XP_012092410.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Jatropha curcas] Length = 941 Score = 159 bits (402), Expect = 7e-37 Identities = 71/82 (86%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER EKE+LL+HHSEK+AVAFGLI+TP GAPIRVKKNLR+C DCHT FK+ICKIVSREI Sbjct: 860 DVERNEKEQLLFHHSEKLAVAFGLIATPPGAPIRVKKNLRICVDCHTVFKYICKIVSREI 919 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHFRDG CSCGDYW Sbjct: 920 IVRDINRFHHFRDGFCSCGDYW 941 >gb|KDP21001.1| hypothetical protein JCGZ_21472 [Jatropha curcas] Length = 858 Score = 159 bits (402), Expect = 7e-37 Identities = 71/82 (86%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER EKE+LL+HHSEK+AVAFGLI+TP GAPIRVKKNLR+C DCHT FK+ICKIVSREI Sbjct: 777 DVERNEKEQLLFHHSEKLAVAFGLIATPPGAPIRVKKNLRICVDCHTVFKYICKIVSREI 836 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHFRDG CSCGDYW Sbjct: 837 IVRDINRFHHFRDGFCSCGDYW 858 >ref|XP_002273710.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vitis vinifera] Length = 933 Score = 159 bits (402), Expect = 7e-37 Identities = 72/82 (87%), Positives = 78/82 (95%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE++EKE LLYHHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFK+ICKIVSREI Sbjct: 852 DVEQSEKELLLYHHSEKLAVAFGLIATPQGAPIRVKKNLRVCVDCHTAFKYICKIVSREI 911 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 912 IVRDINRFHHFKDGSCSCGDYW 933 >emb|CAN74095.1| hypothetical protein VITISV_023708 [Vitis vinifera] Length = 906 Score = 159 bits (402), Expect = 7e-37 Identities = 72/82 (87%), Positives = 78/82 (95%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE++EKE LLYHHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFK+ICKIVSREI Sbjct: 825 DVEQSEKELLLYHHSEKLAVAFGLIATPQGAPIRVKKNLRVCVDCHTAFKYICKIVSREI 884 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 885 IVRDINRFHHFKDGSCSCGDYW 906 >ref|XP_012481451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Gossypium raimondii] gi|763760527|gb|KJB27781.1| hypothetical protein B456_005G009200 [Gossypium raimondii] Length = 933 Score = 157 bits (398), Expect = 2e-36 Identities = 72/82 (87%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER EKEKLLYHHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFI KIVSREI Sbjct: 852 DVERDEKEKLLYHHSEKLAVAFGLIATPAGAPIRVKKNLRVCMDCHTAFKFISKIVSREI 911 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINR+HHF+DG CSCGDYW Sbjct: 912 ILRDINRYHHFKDGSCSCGDYW 933 >ref|XP_007025555.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508780921|gb|EOY28177.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 946 Score = 157 bits (398), Expect = 2e-36 Identities = 72/82 (87%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER EKE+LLYHHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFI KIVSREI Sbjct: 865 DVERGEKEELLYHHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFISKIVSREI 924 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINR+HHF+DG CSCGDYW Sbjct: 925 IVRDINRYHHFKDGSCSCGDYW 946 >gb|KHN07701.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 927 Score = 155 bits (393), Expect = 8e-36 Identities = 68/82 (82%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 +V+++EKEKLLYHHSEK+AVAFGLI+TP G PIRVKKNLR+C DCHT FKF+CKIVSREI Sbjct: 846 NVDKSEKEKLLYHHSEKLAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREI 905 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 906 IVRDINRFHHFKDGSCSCGDYW 927 >ref|XP_003545972.2| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Glycine max] Length = 930 Score = 155 bits (393), Expect = 8e-36 Identities = 68/82 (82%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 +V+++EKEKLLYHHSEK+AVAFGLI+TP G PIRVKKNLR+C DCHT FKF+CKIVSREI Sbjct: 849 NVDKSEKEKLLYHHSEKLAVAFGLIATPPGGPIRVKKNLRICVDCHTFFKFVCKIVSREI 908 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 909 IVRDINRFHHFKDGSCSCGDYW 930 >ref|XP_007153023.1| hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] gi|561026377|gb|ESW25017.1| hypothetical protein PHAVU_003G001300g [Phaseolus vulgaris] Length = 858 Score = 155 bits (392), Expect = 1e-35 Identities = 69/82 (84%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 +V R+EKEKLLYHHSEK+AVAFGLI+TP GAPIRVKKNLR+C DCH FKF+CKIVSREI Sbjct: 777 NVNRSEKEKLLYHHSEKLAVAFGLIATPPGAPIRVKKNLRICVDCHIFFKFVCKIVSREI 836 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 837 IVRDINRFHHFKDGSCSCGDYW 858 >ref|XP_008787073.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Phoenix dactylifera] Length = 929 Score = 154 bits (390), Expect = 2e-35 Identities = 71/82 (86%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE++EKE LL HHSEK+AVAFGLISTP GAPIRVKKNLR+C DCHTAFKFI KIVSREI Sbjct: 848 DVEQSEKEVLLSHHSEKLAVAFGLISTPAGAPIRVKKNLRMCKDCHTAFKFISKIVSREI 907 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINRFHHFRDG CSCGDYW Sbjct: 908 IIRDINRFHHFRDGSCSCGDYW 929 >ref|XP_007214178.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica] gi|462410043|gb|EMJ15377.1| hypothetical protein PRUPE_ppa019185mg [Prunus persica] Length = 858 Score = 154 bits (390), Expect = 2e-35 Identities = 70/82 (85%), Positives = 77/82 (93%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE +EK++LL +HSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFICKIVSREI Sbjct: 777 DVEHSEKQRLLRYHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREI 836 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCGDYW Sbjct: 837 IVRDINRFHHFKDGSCSCGDYW 858 >ref|XP_011027784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Populus euphratica] Length = 951 Score = 154 bits (389), Expect = 2e-35 Identities = 70/82 (85%), Positives = 75/82 (91%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER+EKE+LLYHHSEK+AVAFGLI+TP GAPIRVKKNLR+C DCHT KFI KIVSREI Sbjct: 870 DVERSEKEQLLYHHSEKLAVAFGLIATPPGAPIRVKKNLRICFDCHTVLKFISKIVSREI 929 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRD NRFHHFRDG CSCGDYW Sbjct: 930 IVRDTNRFHHFRDGSCSCGDYW 951 >ref|XP_010932118.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Elaeis guineensis] Length = 928 Score = 154 bits (389), Expect = 2e-35 Identities = 71/82 (86%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE++EKE LL HHSEK+AVAFGLISTP GAPIRVKKNLRVC DCHTAFKFI +IVSREI Sbjct: 847 DVEQSEKEVLLSHHSEKLAVAFGLISTPAGAPIRVKKNLRVCKDCHTAFKFISQIVSREI 906 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINRFHHFRDG CSCGDYW Sbjct: 907 IIRDINRFHHFRDGSCSCGDYW 928 >ref|XP_011651139.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Cucumis sativus] gi|700202221|gb|KGN57354.1| hypothetical protein Csa_3G180420 [Cucumis sativus] Length = 924 Score = 154 bits (388), Expect = 3e-35 Identities = 70/82 (85%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE+ EKE+LL+HHSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFI K+ SREI Sbjct: 843 DVEQIEKEQLLWHHSEKLAVAFGLIATPPGAPIRVKKNLRVCIDCHTAFKFISKVASREI 902 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHFRDG CSCGDYW Sbjct: 903 IVRDINRFHHFRDGSCSCGDYW 924 >ref|XP_008225136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Prunus mume] Length = 947 Score = 153 bits (387), Expect = 4e-35 Identities = 69/82 (84%), Positives = 78/82 (95%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVE++EK++LL +HSEK+AVAFGLI+TP GAPIRVKKNLRVC DCHTAFKFICKIVSREI Sbjct: 866 DVEQSEKQRLLRYHSEKLAVAFGLIATPPGAPIRVKKNLRVCVDCHTAFKFICKIVSREI 925 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 IVRDINRFHHF+DG CSCG+YW Sbjct: 926 IVRDINRFHHFKDGSCSCGEYW 947 >ref|XP_009797200.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] gi|698503178|ref|XP_009797201.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] gi|698503181|ref|XP_009797202.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] gi|698503183|ref|XP_009797203.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] gi|698503185|ref|XP_009797205.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana sylvestris] Length = 883 Score = 152 bits (385), Expect = 7e-35 Identities = 69/82 (84%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER +KE LL +HSEK+AVAFGLI+TP GAPIRVKKNLR+C DCHTAFKFICKIVSREI Sbjct: 802 DVERKQKEILLSYHSEKLAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREI 861 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINRFHHF+DG CSCGDYW Sbjct: 862 IIRDINRFHHFKDGSCSCGDYW 883 >ref|XP_009600826.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183609|ref|XP_009600827.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183611|ref|XP_009600828.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183613|ref|XP_009600829.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183615|ref|XP_009600830.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183617|ref|XP_009600831.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183619|ref|XP_009600833.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] gi|697183621|ref|XP_009600834.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tomentosiformis] Length = 883 Score = 152 bits (385), Expect = 7e-35 Identities = 69/82 (84%), Positives = 76/82 (92%) Frame = -2 Query: 408 DVERAEKEKLLYHHSEKIAVAFGLISTPTGAPIRVKKNLRVCGDCHTAFKFICKIVSREI 229 DVER +KE LL +HSEK+AVAFGLI+TP GAPIRVKKNLR+C DCHTAFKFICKIVSREI Sbjct: 802 DVERIQKEILLSYHSEKLAVAFGLIATPPGAPIRVKKNLRICLDCHTAFKFICKIVSREI 861 Query: 228 IVRDINRFHHFRDGLCSCGDYW 163 I+RDINRFHHF+DG CSCGDYW Sbjct: 862 IIRDINRFHHFKDGSCSCGDYW 883