BLASTX nr result
ID: Cinnamomum24_contig00017235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00017235 (408 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa a... 105 1e-20 gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes ... 105 1e-20 ref|XP_012088816.1| PREDICTED: hydrophobic protein LTI6B-like [J... 105 1e-20 ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoeni... 105 2e-20 dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] 105 2e-20 ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] g... 104 2e-20 gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indi... 104 2e-20 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 104 2e-20 ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [M... 104 3e-20 dbj|BAD34659.1| plasma membrane protein 3 [Leymus chinensis] 104 3e-20 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 103 3e-20 ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatu... 103 4e-20 gb|ACN26849.1| unknown [Zea mays] gi|413917611|gb|AFW57543.1| na... 103 6e-20 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer ... 103 6e-20 ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B [Brachy... 103 6e-20 ref|NP_001107634.1| LOC100135422 [Zea mays] gi|165881887|gb|ABY7... 103 6e-20 ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like is... 102 7e-20 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 102 7e-20 ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [S... 102 7e-20 ref|XP_006382256.1| hypothetical protein POPTR_0005s00390g [Popu... 102 1e-19 >ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] gi|695058893|ref|XP_009417777.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] Length = 54 Score = 105 bits (262), Expect = 1e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+CIDILVA++LPPLGVFLKFGC EFW+CLLLTILGYIPGIIYA+YAITK Sbjct: 1 MGTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAIYAITK 54 >gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica] Length = 57 Score = 105 bits (262), Expect = 1e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTASCIDIL+A++LPPLGVFLKFGCG EFWICLLLT LGY+PGIIYAVYAITK Sbjct: 5 GTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYLPGIIYAVYAITK 57 >ref|XP_012088816.1| PREDICTED: hydrophobic protein LTI6B-like [Jatropha curcas] gi|257219544|gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] gi|643708412|gb|KDP23328.1| hypothetical protein JCGZ_23161 [Jatropha curcas] Length = 57 Score = 105 bits (262), Expect = 1e-20 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+CIDIL+AV+LPPLGVFLKFGC AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 5 GTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] gi|672195917|ref|XP_008776671.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] Length = 57 Score = 105 bits (261), Expect = 2e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+C+DIL+A++LPPLGVFLKFGC AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 5 GTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] Length = 54 Score = 105 bits (261), Expect = 2e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+CIDI++A++LPPLGVFLKFGCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 1 MGTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 54 >ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] gi|122169560|sp|Q0DKW8.1|LTI6B_ORYSJ RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|158513180|sp|A2Y075.2|LTI6B_ORYSI RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|21314334|gb|AAM46894.1|AF503583_1 early drought induced protein [Oryza sativa Indica Group] gi|45602865|gb|AAS72306.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group] gi|47717901|gb|AAT37942.1| low temperature-induced low molecular weight integral membrane protein LTI6b [Oryza sativa Japonica Group] gi|113578142|dbj|BAF16505.1| Os05g0138300 [Oryza sativa Japonica Group] Length = 55 Score = 104 bits (260), Expect = 2e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+CIDIL+A++LPPLGVFLKFGCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55 >gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indica Group] gi|222630128|gb|EEE62260.1| hypothetical protein OsJ_17047 [Oryza sativa Japonica Group] Length = 92 Score = 104 bits (260), Expect = 2e-20 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+CIDIL+A++LPPLGVFLKFGCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 104 bits (260), Expect = 2e-20 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+C+DI++AV+LPPLGVFLKFGC AEFWICLLLTILGYIPGIIYAVY ITK Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 54 Score = 104 bits (259), Expect = 3e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+C+D+LVA++LPPLGVFLKFGC EFW+CLLLTILGYIPGIIYAVYAITK Sbjct: 1 MGTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAVYAITK 54 >dbj|BAD34659.1| plasma membrane protein 3 [Leymus chinensis] Length = 54 Score = 104 bits (259), Expect = 3e-20 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+CIDI++A++LPPLGVFLKFGCG EFWICLLLT LG+IPGIIYA+YAITK Sbjct: 1 MGTATCIDIIIAIILPPLGVFLKFGCGHEFWICLLLTFLGFIPGIIYAIYAITK 54 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 103 bits (258), Expect = 3e-20 Identities = 50/62 (80%), Positives = 55/62 (88%), Gaps = 3/62 (4%) Frame = -3 Query: 196 KRQKRMG---TASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAI 26 K Q +M TA+C+DIL+AV+LPPLGVFLKFGC AEFWICLLLTILGYIPGIIYAVYAI Sbjct: 42 KNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 101 Query: 25 TK 20 TK Sbjct: 102 TK 103 >ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| low temperature and salt responsive family protein [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 103 bits (257), Expect = 4e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+CIDI++A++LPPLGVFLKFGC EFWICL+LTILGY+PGIIYA+YAITK Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >gb|ACN26849.1| unknown [Zea mays] gi|413917611|gb|AFW57543.1| naCl stress protein1 [Zea mays] Length = 58 Score = 103 bits (256), Expect = 6e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+C+DIL+A++LPPLGVFLK+GCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIYAITK 56 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 103 bits (256), Expect = 6e-20 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+C+DI++A++LPPLGVFLKFGC EFWICL+LTILGY+PGIIYA+YAITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIYAITK 54 >ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B [Brachypodium distachyon] gi|326512942|dbj|BAK03378.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|473882221|gb|EMS48019.1| Hydrophobic protein LTI6B [Triticum urartu] Length = 55 Score = 103 bits (256), Expect = 6e-20 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+CIDI++A++LPPLGVFLKFGCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 3 GTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55 >ref|NP_001107634.1| LOC100135422 [Zea mays] gi|165881887|gb|ABY71210.1| early drought induced protein [Zea mays] gi|195609864|gb|ACG26762.1| hydrophobic protein LTI6B [Zea mays] gi|195623414|gb|ACG33537.1| hydrophobic protein LTI6B [Zea mays] Length = 58 Score = 103 bits (256), Expect = 6e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+C+DIL+A++LPPLGVFLK+GCG EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLTFLGYIPGIIYAIYAITK 56 >ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus sinensis] gi|568853390|ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus sinensis] gi|641837449|gb|KDO56403.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis] gi|641837450|gb|KDO56404.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis] Length = 58 Score = 102 bits (255), Expect = 7e-20 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -3 Query: 175 TASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 TA+C+DIL+AV+LPPLGVFLKFGC AEFWICLLLTILGYIPGIIYAVYAITK Sbjct: 6 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 102 bits (255), Expect = 7e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 181 MGTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 MGTA+C+DI++A++LPPLGVFL+FGC EFWICLLLTILGYIPGIIYA+YAITK Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIYAITK 54 >ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor] gi|241945842|gb|EES18987.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor] Length = 57 Score = 102 bits (255), Expect = 7e-20 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 GTA+C+DIL+A++LPPLGVFLKFGCG +FWICLLLT LGY+PGIIYAVYAITK Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCGHQFWICLLLTFLGYLPGIIYAVYAITK 56 >ref|XP_006382256.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa] gi|550337608|gb|ERP60053.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa] Length = 55 Score = 102 bits (254), Expect = 1e-19 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -3 Query: 178 GTASCIDILVAVLLPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYAITK 20 G CIDIL+A++LPPLGVFL+FGCG EFWICLLLTILGYIPGIIYAVYAITK Sbjct: 3 GAVKCIDILIAIILPPLGVFLRFGCGVEFWICLLLTILGYIPGIIYAVYAITK 55