BLASTX nr result
ID: Cinnamomum24_contig00016485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00016485 (560 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW63263.1| hypothetical protein ZEAMMB73_381801 [Zea mays] 57 5e-06 >gb|AFW63263.1| hypothetical protein ZEAMMB73_381801 [Zea mays] Length = 244 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/61 (44%), Positives = 40/61 (65%) Frame = +3 Query: 255 MLILALGCSVIPLTLFIPPCRLFTLFVAKLQSIQRTVASLRTAYPRAWARLRSIPSASFS 434 MLILALG +IP+TL PCR L VAKLQ ++ ++ R++YP AW+ + I + S + Sbjct: 1 MLILALGVWLIPMTLIFAPCRRLVLLVAKLQELRASIMRGRSSYPAAWSLVTRIQTISIT 60 Query: 435 V 437 + Sbjct: 61 L 61