BLASTX nr result
ID: Cinnamomum24_contig00016245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00016245 (311 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010939730.1| PREDICTED: SNW/SKI-interacting protein-like ... 60 4e-07 ref|XP_010939731.1| PREDICTED: SNW/SKI-interacting protein-like ... 57 6e-06 ref|XP_002324443.2| chromatin family protein [Populus trichocarp... 56 8e-06 >ref|XP_010939730.1| PREDICTED: SNW/SKI-interacting protein-like isoform X1 [Elaeis guineensis] Length = 621 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 133 FVSHTDFTMAALKELLPPARXXXXSFYDHSKDPWFQDRFNSS 8 F+ +D M ALKELLPPA+ SFYDHSKDPWF+DR++SS Sbjct: 19 FIPRSDPLMEALKELLPPAKSTGASFYDHSKDPWFKDRYSSS 60 >ref|XP_010939731.1| PREDICTED: SNW/SKI-interacting protein-like isoform X2 [Elaeis guineensis] Length = 595 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 109 MAALKELLPPARXXXXSFYDHSKDPWFQDRFNSS 8 M ALKELLPPA+ SFYDHSKDPWF+DR++SS Sbjct: 1 MEALKELLPPAKSTGASFYDHSKDPWFKDRYSSS 34 >ref|XP_002324443.2| chromatin family protein [Populus trichocarpa] gi|550318383|gb|EEF03008.2| chromatin family protein [Populus trichocarpa] Length = 610 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -2 Query: 109 MAALKELLPPARXXXXSFYDHSKDPWFQDRFNSSE 5 MAALKELLPPA+ ++YDHS DPWF+ RF+SSE Sbjct: 1 MAALKELLPPAKSTSATYYDHSNDPWFKQRFSSSE 35