BLASTX nr result
ID: Cinnamomum24_contig00015626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00015626 (427 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010919005.1| PREDICTED: uncharacterized protein LOC105043... 57 5e-06 >ref|XP_010919005.1| PREDICTED: uncharacterized protein LOC105043234 [Elaeis guineensis] Length = 177 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 426 DNSELPGAYANSNCQAVNNSIMMNGSYTAEDPGIHIFISEY 304 D+ AY NSN QAVNNSI++ GS+ AEDPG+HI IS+Y Sbjct: 81 DDETAMSAYTNSNYQAVNNSILLGGSFKAEDPGVHIVISDY 121