BLASTX nr result
ID: Cinnamomum24_contig00014744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00014744 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012468211.1| PREDICTED: argininosuccinate synthase, chlor... 69 9e-10 ref|XP_012468196.1| PREDICTED: argininosuccinate synthase, chlor... 69 9e-10 ref|XP_012468204.1| PREDICTED: argininosuccinate synthase, chlor... 69 9e-10 ref|XP_007037945.1| Arginosuccinate synthase family isoform 1 [T... 69 1e-09 ref|XP_004515824.1| PREDICTED: argininosuccinate synthase, chlor... 69 2e-09 ref|XP_003613940.1| Argininosuccinate synthase [Medicago truncat... 69 2e-09 ref|XP_007209940.1| hypothetical protein PRUPE_ppa004728mg [Prun... 68 3e-09 ref|XP_010105234.1| Argininosuccinate synthase [Morus notabilis]... 67 4e-09 ref|XP_008239446.1| PREDICTED: argininosuccinate synthase, chlor... 66 8e-09 ref|XP_011463288.1| PREDICTED: argininosuccinate synthase, chlor... 65 1e-08 gb|KHN14094.1| Argininosuccinate synthase, chloroplastic [Glycin... 65 1e-08 ref|XP_006600802.1| PREDICTED: argininosuccinate synthase, chlor... 65 1e-08 ref|XP_009359455.1| PREDICTED: argininosuccinate synthase, chlor... 65 2e-08 ref|XP_008374298.1| PREDICTED: argininosuccinate synthase, chlor... 65 2e-08 gb|KDO52619.1| hypothetical protein CISIN_1g011097mg [Citrus sin... 65 2e-08 ref|XP_006440086.1| hypothetical protein CICLE_v10019860mg [Citr... 65 2e-08 gb|KHN21584.1| Argininosuccinate synthase, chloroplastic [Glycin... 64 3e-08 ref|XP_006580438.1| PREDICTED: argininosuccinate synthase, chlor... 64 3e-08 ref|XP_003525243.1| PREDICTED: argininosuccinate synthase, chlor... 64 3e-08 ref|XP_003608852.1| Argininosuccinate synthase [Medicago truncat... 64 3e-08 >ref|XP_012468211.1| PREDICTED: argininosuccinate synthase, chloroplastic isoform X3 [Gossypium raimondii] Length = 488 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +3 Query: 129 PEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 P+ + + L+ DVS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 60 PKNQGIQAVLSGNSGTDVSTVTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 109 >ref|XP_012468196.1| PREDICTED: argininosuccinate synthase, chloroplastic isoform X1 [Gossypium raimondii] gi|763740530|gb|KJB08029.1| hypothetical protein B456_001G059900 [Gossypium raimondii] Length = 510 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +3 Query: 129 PEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 P+ + + L+ DVS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 82 PKNQGIQAVLSGNSGTDVSTVTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 131 >ref|XP_012468204.1| PREDICTED: argininosuccinate synthase, chloroplastic isoform X2 [Gossypium raimondii] gi|763740529|gb|KJB08028.1| hypothetical protein B456_001G059900 [Gossypium raimondii] Length = 494 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +3 Query: 129 PEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 P+ + + L+ DVS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 66 PKNQGIQAVLSGNSGTDVSTVTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 115 >ref|XP_007037945.1| Arginosuccinate synthase family isoform 1 [Theobroma cacao] gi|508775190|gb|EOY22446.1| Arginosuccinate synthase family isoform 1 [Theobroma cacao] Length = 494 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +3 Query: 144 LNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 + + L+S+R+ +VS T+ GGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 71 IRAVLSSDREMEVSTATKAGGLRGKLNKVVLAYSGGLDTSVIVPW 115 >ref|XP_004515824.1| PREDICTED: argininosuccinate synthase, chloroplastic [Cicer arietinum] Length = 478 Score = 68.6 bits (166), Expect = 2e-09 Identities = 44/96 (45%), Positives = 53/96 (55%), Gaps = 9/96 (9%) Frame = +3 Query: 18 PSLPCIFIPPADICR*LANCMAQSQKIAPPNPSSFN---------APEKSVLNSELASER 170 PS PC+ PP+ N + A NP SF A V+ + + S+ Sbjct: 8 PSHPCVSTPPS--LHATDNILFNRSWKA--NPCSFKELRPRGNVGAGRLQVVKAVVRSDT 63 Query: 171 DNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 D +VS +G GLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 64 DVEVSEAKKGSGLRGKLNKVVLAYSGGLDTSVIVPW 99 >ref|XP_003613940.1| Argininosuccinate synthase [Medicago truncatula] gi|355515275|gb|AES96898.1| argininosuccinate synthase [Medicago truncatula] Length = 480 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +3 Query: 114 SSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 +S +A V+ + L S+ D +VS +G GLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 47 TSVDATRLQVVKAVLRSDTDVEVSEAKKGSGLRGKLNKVVLAYSGGLDTSVIVPW 101 >ref|XP_007209940.1| hypothetical protein PRUPE_ppa004728mg [Prunus persica] gi|462405675|gb|EMJ11139.1| hypothetical protein PRUPE_ppa004728mg [Prunus persica] Length = 494 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = +3 Query: 96 IAPPNPSSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVP 275 ++ N S A +K V+ + L S + +VS T+ GLRGKLNKVVLAYSGGLDTSVIVP Sbjct: 57 VSSGNGSVTRAHDKQVIRAVLPSYSETEVSGSTKERGLRGKLNKVVLAYSGGLDTSVIVP 116 Query: 276 W 278 W Sbjct: 117 W 117 >ref|XP_010105234.1| Argininosuccinate synthase [Morus notabilis] gi|587916458|gb|EXC04121.1| Argininosuccinate synthase [Morus notabilis] Length = 925 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/57 (57%), Positives = 41/57 (71%) Frame = +3 Query: 108 NPSSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 N S ++ K V+ + L S+++ +S T GGLRGKL KVVLAYSGGLDTSVIVPW Sbjct: 490 NGSVNSSHNKQVIRAALPSQKELKISEATNNGGLRGKLKKVVLAYSGGLDTSVIVPW 546 >ref|XP_008239446.1| PREDICTED: argininosuccinate synthase, chloroplastic [Prunus mume] Length = 494 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/61 (57%), Positives = 42/61 (68%) Frame = +3 Query: 96 IAPPNPSSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVP 275 ++ N S A K V+ + L S + +VS T+ GLRGKLNKVVLAYSGGLDTSVIVP Sbjct: 57 VSSGNGSVTRAHGKQVIRAVLPSYSETEVSGSTKERGLRGKLNKVVLAYSGGLDTSVIVP 116 Query: 276 W 278 W Sbjct: 117 W 117 >ref|XP_011463288.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 495 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +3 Query: 141 VLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 V + L S D +V+ T G GLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 70 VTRAALPSYNDTEVAGSTNGSGLRGKLNKVVLAYSGGLDTSVIVPW 115 >gb|KHN14094.1| Argininosuccinate synthase, chloroplastic [Glycine soja] Length = 452 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +3 Query: 114 SSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 +S A + V+ + S+ + VS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 45 TSIGATKLKVIKAAARSDTEV-VSESTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 98 >ref|XP_006600802.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Glycine max] Length = 477 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = +3 Query: 114 SSFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 +S A + V+ + S+ + VS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 45 TSIGATKLKVIKAAARSDTEV-VSESTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 98 >ref|XP_009359455.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Pyrus x bretschneideri] gi|694358054|ref|XP_009359456.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Pyrus x bretschneideri] Length = 493 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +3 Query: 117 SFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 S A K V+ + L + + +VS T+ GLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 63 SVRAHNKQVIRAVLPTYSETEVSGSTKERGLRGKLNKVVLAYSGGLDTSVIVPW 116 >ref|XP_008374298.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Malus domestica] gi|658000979|ref|XP_008392952.1| PREDICTED: argininosuccinate synthase, chloroplastic-like [Malus domestica] Length = 135 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = +3 Query: 117 SFNAPEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 S A K V+ + L + + +VS T+ GLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 63 SVRAHNKQVIRAVLPTYSETEVSGSTKERGLRGKLNKVVLAYSGGLDTSVIVPW 116 >gb|KDO52619.1| hypothetical protein CISIN_1g011097mg [Citrus sinensis] Length = 493 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 126 APEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 A E + + L+SER+ + S P GGG RGKLNKVVLAYSGGLDTSVIVPW Sbjct: 65 ACEPKAIQALLSSEREVE-SAPKSGGGRRGKLNKVVLAYSGGLDTSVIVPW 114 >ref|XP_006440086.1| hypothetical protein CICLE_v10019860mg [Citrus clementina] gi|557542348|gb|ESR53326.1| hypothetical protein CICLE_v10019860mg [Citrus clementina] Length = 493 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 126 APEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 A E + + L+SER+ + S P GGG RGKLNKVVLAYSGGLDTSVIVPW Sbjct: 65 ACEPKAIQALLSSEREVE-SAPKSGGGRRGKLNKVVLAYSGGLDTSVIVPW 114 >gb|KHN21584.1| Argininosuccinate synthase, chloroplastic [Glycine soja] Length = 485 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 180 VSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 VS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 72 VSETTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 104 >ref|XP_006580438.1| PREDICTED: argininosuccinate synthase, chloroplastic isoform X2 [Glycine max] Length = 496 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 180 VSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 VS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 85 VSETTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 117 >ref|XP_003525243.1| PREDICTED: argininosuccinate synthase, chloroplastic isoform X1 [Glycine max] Length = 483 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 180 VSRPTRGGGLRGKLNKVVLAYSGGLDTSVIVPW 278 VS T+GGGLRGKLNKVVLAYSGGLDTSVIVPW Sbjct: 72 VSETTKGGGLRGKLNKVVLAYSGGLDTSVIVPW 104 >ref|XP_003608852.1| Argininosuccinate synthase [Medicago truncatula] gi|355509907|gb|AES91049.1| argininosuccinate synthase [Medicago truncatula] Length = 478 Score = 64.3 bits (155), Expect = 3e-08 Identities = 36/66 (54%), Positives = 41/66 (62%), Gaps = 9/66 (13%) Frame = +3 Query: 108 NPSSFN---------APEKSVLNSELASERDNDVSRPTRGGGLRGKLNKVVLAYSGGLDT 260 NP SF A V+ + S+ D +VS +G GLRGKLNKVVLAYSGGLDT Sbjct: 34 NPCSFKKLKPRAGVAAGRLQVVKAVSHSDTDVEVSEAKKGSGLRGKLNKVVLAYSGGLDT 93 Query: 261 SVIVPW 278 SVIVPW Sbjct: 94 SVIVPW 99