BLASTX nr result
ID: Cinnamomum24_contig00014634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00014634 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857823.2| PREDICTED: 40S ribosomal protein S13 [Ambore... 68 2e-09 ref|XP_010909723.1| PREDICTED: 40S ribosomal protein S13-like [E... 68 2e-09 ref|XP_010941042.1| PREDICTED: 40S ribosomal protein S13 [Elaeis... 68 2e-09 ref|XP_010934667.1| PREDICTED: 40S ribosomal protein S13-like [E... 68 2e-09 ref|XP_002280012.2| PREDICTED: 40S ribosomal protein S13 [Vitis ... 68 2e-09 ref|XP_010264161.1| PREDICTED: 40S ribosomal protein S13-like [N... 68 2e-09 ref|XP_010276732.1| PREDICTED: 40S ribosomal protein S13 [Nelumb... 68 2e-09 ref|XP_008803987.1| PREDICTED: 40S ribosomal protein S13 [Phoeni... 68 2e-09 ref|XP_006833344.1| PREDICTED: 40S ribosomal protein S13 [Ambore... 68 2e-09 emb|CAN69640.1| hypothetical protein VITISV_028568 [Vitis vinife... 68 2e-09 ref|XP_010108141.1| 40S ribosomal protein S13 [Morus notabilis] ... 67 5e-09 dbj|BAA96366.1| cytoplasmic ribosomal protein S13 [Panax ginseng] 67 5e-09 gb|KJB22315.1| hypothetical protein B456_004G040700 [Gossypium r... 67 5e-09 gb|KJB22314.1| hypothetical protein B456_004G040700 [Gossypium r... 67 5e-09 ref|XP_012473344.1| PREDICTED: 40S ribosomal protein S13-like [G... 67 5e-09 gb|KJB09907.1| hypothetical protein B456_001G174200, partial [Go... 67 5e-09 ref|XP_011101131.1| PREDICTED: 40S ribosomal protein S13-like [S... 67 5e-09 ref|XP_011076311.1| PREDICTED: 40S ribosomal protein S13-like [S... 67 5e-09 ref|XP_011034166.1| PREDICTED: 40S ribosomal protein S13-like [P... 67 5e-09 ref|XP_010683648.1| PREDICTED: 40S ribosomal protein S13 [Beta v... 67 5e-09 >ref|XP_006857823.2| PREDICTED: 40S ribosomal protein S13 [Amborella trichopoda] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_010909723.1| PREDICTED: 40S ribosomal protein S13-like [Elaeis guineensis] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_010941042.1| PREDICTED: 40S ribosomal protein S13 [Elaeis guineensis] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_010934667.1| PREDICTED: 40S ribosomal protein S13-like [Elaeis guineensis] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_002280012.2| PREDICTED: 40S ribosomal protein S13 [Vitis vinifera] Length = 187 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 148 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 178 >ref|XP_010264161.1| PREDICTED: 40S ribosomal protein S13-like [Nelumbo nucifera] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_010276732.1| PREDICTED: 40S ribosomal protein S13 [Nelumbo nucifera] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_008803987.1| PREDICTED: 40S ribosomal protein S13 [Phoenix dactylifera] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_006833344.1| PREDICTED: 40S ribosomal protein S13 [Amborella trichopoda] gi|769820940|ref|XP_011620561.1| PREDICTED: 40S ribosomal protein S13 [Amborella trichopoda] gi|548838020|gb|ERM98622.1| hypothetical protein AMTR_s00109p00088200 [Amborella trichopoda] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >emb|CAN69640.1| hypothetical protein VITISV_028568 [Vitis vinifera] gi|296089171|emb|CBI38874.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYKRTKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 142 >ref|XP_010108141.1| 40S ribosomal protein S13 [Morus notabilis] gi|587930764|gb|EXC17873.1| 40S ribosomal protein S13 [Morus notabilis] Length = 131 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 92 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 122 >dbj|BAA96366.1| cytoplasmic ribosomal protein S13 [Panax ginseng] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142 >gb|KJB22315.1| hypothetical protein B456_004G040700 [Gossypium raimondii] Length = 147 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 108 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 138 >gb|KJB22314.1| hypothetical protein B456_004G040700 [Gossypium raimondii] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142 >ref|XP_012473344.1| PREDICTED: 40S ribosomal protein S13-like [Gossypium raimondii] gi|763754982|gb|KJB22313.1| hypothetical protein B456_004G040700 [Gossypium raimondii] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142 >gb|KJB09907.1| hypothetical protein B456_001G174200, partial [Gossypium raimondii] Length = 171 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 132 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 162 >ref|XP_011101131.1| PREDICTED: 40S ribosomal protein S13-like [Sesamum indicum] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142 >ref|XP_011076311.1| PREDICTED: 40S ribosomal protein S13-like [Sesamum indicum] Length = 143 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 104 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 134 >ref|XP_011034166.1| PREDICTED: 40S ribosomal protein S13-like [Populus euphratica] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142 >ref|XP_010683648.1| PREDICTED: 40S ribosomal protein S13 [Beta vulgaris subsp. vulgaris] gi|870854965|gb|KMT06713.1| hypothetical protein BVRB_7g158750 [Beta vulgaris subsp. vulgaris] Length = 151 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 321 KFRLILVESRIHRLARYYKRTKKLPPVWKYE 229 KFRLILVESRIHRLARYYK+TKKLPPVWKYE Sbjct: 112 KFRLILVESRIHRLARYYKKTKKLPPVWKYE 142