BLASTX nr result
ID: Cinnamomum24_contig00014318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00014318 (497 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010263506.1| PREDICTED: probable serine/threonine-protein... 63 9e-08 >ref|XP_010263506.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 [Nelumbo nucifera] Length = 524 Score = 62.8 bits (151), Expect = 9e-08 Identities = 33/51 (64%), Positives = 37/51 (72%) Frame = -1 Query: 497 DRRGGRDKGHTCCDSQQEQAKLLEKQPTESGDSSSYESCIHANKARWRKQQ 345 DRRGGRD G DS +E KL+EKQ T SGDSS YES AN+ARWRKQ+ Sbjct: 470 DRRGGRDAGRAHHDSMKE--KLIEKQVTVSGDSSGYESGNQANRARWRKQE 518