BLASTX nr result
ID: Cinnamomum24_contig00013114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00013114 (354 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15287.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_010243267.1| PREDICTED: alpha carbonic anhydrase 7-like [... 56 8e-06 ref|XP_004303634.1| PREDICTED: alpha carbonic anhydrase 4-like [... 56 8e-06 >emb|CDP15287.1| unnamed protein product [Coffea canephora] Length = 297 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 2 WTVLKEPCIRPVSFDQVKKLRDAVHDYARSNARPIQQFNGRELLLNEPA 148 WT+ ++ +R VS DQV LR+AVHDYA NARPIQQ NGR++ L PA Sbjct: 249 WTINRK--VRTVSRDQVMLLREAVHDYAERNARPIQQQNGRDIYLYGPA 295 >ref|XP_010243267.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera] Length = 212 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +2 Query: 2 WTVLKEPCIRPVSFDQVKKLRDAVHDYARSNARPIQQFNGRELLLNEP 145 WT+ + +R VS DQVK LRDAVHDYA NARP+Q N RE+ L P Sbjct: 158 WTINTK--VRTVSKDQVKALRDAVHDYAEQNARPLQPLNNREIHLYRP 203 >ref|XP_004303634.1| PREDICTED: alpha carbonic anhydrase 4-like [Fragaria vesca subsp. vesca] Length = 286 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +2 Query: 2 WTVLKEPCIRPVSFDQVKKLRDAVHDYARSNARPIQQFNGRELLLNEPAPN 154 WT++K+ +R VS +QV+ +R+ VHD +NARP QQFNGR +LL P N Sbjct: 234 WTIVKK--VRTVSMEQVRAIRETVHDGYEANARPTQQFNGRPVLLYTPGEN 282