BLASTX nr result
ID: Cinnamomum24_contig00010042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00010042 (557 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 45 6e-09 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 45.1 bits (105), Expect(3) = 6e-09 Identities = 29/56 (51%), Positives = 32/56 (57%) Frame = +1 Query: 328 GELFDSDFFLRVGRRKATSMTERAGNSRGSPLEAKARSTNP*S*PSEAEDGNQSVT 495 G L + FF VGRRKATS+ + AGN RGSPLEA A GNQSVT Sbjct: 117 GCLIAASFFRLVGRRKATSIYKTAGNLRGSPLEAFA--------------GNQSVT 158 Score = 32.0 bits (71), Expect(3) = 6e-09 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 8/36 (22%) Frame = +3 Query: 252 IGALLPSV--------ANPLISNRAERTFGTSVGRA 335 I ALLPS+ ANP +S+RAERTFG RA Sbjct: 81 IRALLPSLRPHHLNLSANPFLSHRAERTFGWYFSRA 116 Score = 29.3 bits (64), Expect(3) = 6e-09 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 314 WYFSRASCLIVTSF 355 WYFSRA CLI SF Sbjct: 111 WYFSRAGCLIAASF 124