BLASTX nr result
ID: Cinnamomum24_contig00009869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum24_contig00009869 (588 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009372220.1| PREDICTED: SKI/DACH domain-containing protei... 57 6e-06 ref|XP_009372219.1| PREDICTED: E3 SUMO-protein ligase CBX4-like ... 57 6e-06 ref|XP_008235426.1| PREDICTED: SKI/DACH domain-containing protei... 57 8e-06 >ref|XP_009372220.1| PREDICTED: SKI/DACH domain-containing protein 1-like isoform X2 [Pyrus x bretschneideri] Length = 132 Score = 57.0 bits (136), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 102 VFVLTDEWMEFFAKSEAKRRLDKQQAKKRG 13 VFVLTDEW EFFAKSEAKR+L+KQQAKK G Sbjct: 96 VFVLTDEWKEFFAKSEAKRKLEKQQAKKEG 125 >ref|XP_009372219.1| PREDICTED: E3 SUMO-protein ligase CBX4-like isoform X1 [Pyrus x bretschneideri] Length = 151 Score = 57.0 bits (136), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 102 VFVLTDEWMEFFAKSEAKRRLDKQQAKKRG 13 VFVLTDEW EFFAKSEAKR+L+KQQAKK G Sbjct: 115 VFVLTDEWKEFFAKSEAKRKLEKQQAKKEG 144 >ref|XP_008235426.1| PREDICTED: SKI/DACH domain-containing protein 1-like [Prunus mume] Length = 147 Score = 56.6 bits (135), Expect = 8e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 102 VFVLTDEWMEFFAKSEAKRRLDKQQAKKR 16 VFVLTDEW EFFAKSEAKRRL+KQQAKK+ Sbjct: 116 VFVLTDEWKEFFAKSEAKRRLEKQQAKKK 144